TRBV7-2 (T cell receptor beta variable 7-2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 28596
Gene name T cell receptor beta variable 7-2
Gene symbol TRBV7-2
Synonyms (NCBI Gene)
TCRBV6S5A1N1TCRBV6S5A2TCRBV7S2TRBV72
Chromosome 7
Chromosome location 7q34
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0007166 Process Cell surface receptor signaling pathway IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A TRBV7-2
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A1B0GXF2
Protein name T cell receptor beta variable 7-2
Protein function V region of the variable domain of T cell receptor (TR) beta chain that participates in the antigen recognition (PubMed:24600447). Alpha-beta T cell receptors are antigen specific receptors which are essential to the immune response and are pres
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 25 → 114 Immunoglobulin V-set domain Domain
Sequence 
MGTRLLFWVAFCLLGADHTGAGVSQSPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQ
GLEFLIYFQGNSAPDKSGLPSDRFSAERTGGSVSTLTIQRTQQEDSAVYLCASSL
Sequence length 115
Interactions View interactions

No strongly related genes found yet for TRBV7-2.

No additional diseases found yet through genes similar to TRBV7-2.