TRBV6-2 (T cell receptor beta variable 6-2)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 28605 |
| Gene name | T cell receptor beta variable 6-2 |
| Gene symbol | TRBV6-2 |
| Synonyms (NCBI Gene) |
TCRBV13S2TCRBV13S2A1TTCRBV6S2TRBV62
|
| Chromosome | 7 |
| Chromosome location | 7q34 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|||||||||||
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
A0A0J9YXY3 | ||||||||||
| Protein name | T cell receptor beta variable 6-2 | ||||||||||
| Protein function | V region of the variable domain of T cell receptor (TR) beta chain that participates in the antigen recognition (PubMed:24600447). Alpha-beta T cell receptors are antigen specific receptors which are essential to the immune response and are pres | ||||||||||
| Family and domains |
Pfam
|
||||||||||
| Sequence |
MSLGLLCCGAFSLLWAGPVNAGVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGM |
||||||||||
| Sequence length | 114 | ||||||||||
| Interactions | View interactions | ||||||||||
|
Related Genes
Genes most often co-reported with TRBV6-2 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to TRBV6-2 (see Related Genes above), that are NOT already directly curated for TRBV6-2 itself -- a lead worth checking, not a confirmed association.
0
|
|