TRAV26-1 (T cell receptor alpha variable 26-1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 28657
Gene name T cell receptor alpha variable 26-1
Gene symbol TRAV26-1
Synonyms (NCBI Gene)
TCRAV26S1TCRAV4S2TRAV261
Chromosome 14
Chromosome location 14q11.2
Summary T cell receptors recognize foreign antigens which have been processed as small peptides and bound to major histocompatibility complex (MHC) molecules at the surface of antigen presenting cells (APC). Each T cell receptor is a dimer consisting of one alpha
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0005886 Component Plasma membrane IEA
GO:0009617 Process Response to bacterium IBA
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A TRAV26-1
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A087WT03
Protein name T cell receptor alpha variable 26-1
Protein function V region of the variable domain of T cell receptor (TR) alpha chain that participates in the antigen recognition (PubMed:24600447). Alpha-beta T cell receptors are antigen specific receptors which are essential to the immune response and are pre
PDB 5WKI , 7NDT
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 22 → 109 Immunoglobulin V-set domain Domain
Sequence 
MRLVARVTVFLTFGTIIDAKTTQPTSMDCAEGRAANLPCNHSTISGNEYVYWYRQIHSQG
PQYIIHGLKNNETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Sequence length 109
Interactions View interactions

No strongly related genes found yet for TRAV26-1.

No additional diseases found yet through genes similar to TRAV26-1.