TRAV23DV6 (T cell receptor alpha variable 23/delta variable 6)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 28660
Gene name T cell receptor alpha variable 23/delta variable 6
Gene symbol TRAV23DV6
Synonyms (NCBI Gene)
TCRAV17S1TRAV23/DV6hADV23S1
Chromosome 14
Chromosome location 14q11.2
Summary T cell receptors recognize foreign antigens which have been processed as small peptides and bound to major histocompatibility complex (MHC) molecules at the surface of antigen presenting cells (APC). Each T cell receptor is a dimer consisting of one alpha
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT017012 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0005886 Component Plasma membrane IEA
GO:0016020 Component Membrane IEA
GO:0042101 Component T cell receptor complex IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A TRAV23/DV6
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A075B6W5
Protein name T cell receptor alpha variable 23/delta variable 6
Protein function V region of the variable domain of T cell receptor (TR) alpha chain that participates in the antigen recognition (PubMed:24600447). Alpha-beta T cell receptors are antigen specific receptors which are essential to the immune response and are pre
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 34 → 121 Immunoglobulin V-set domain Domain
Sequence 
MDKILGASFLVLWLQLCWVSGQQKEKSDQQQVKQSPQSLIVQKGGISIINCAYENTAFDY
FPWYQQFPGKGPALLIAIRPDVSEKKEGRFTISFNKSAKQFSSHIMDSQPGDSATYFCAA
S
Sequence length 121
Interactions View interactions

No strongly related genes found yet for TRAV23DV6.

No additional diseases found yet through genes similar to TRAV23DV6.