Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	28664
Gene name	T cell receptor alpha variable 19
Gene symbol	TRAV19
Synonyms (NCBI Gene)	TCRAV12S1TCRAV19S1
Chromosome	14
Chromosome location	14q11.2
Summary	T cell receptors recognize foreign antigens which have been processed as small peptides and bound to major histocompatibility complex (MHC) molecules at the surface of antigen presenting cells (APC). Each T cell receptor is a dimer consisting of one alpha

11 Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	6440030
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IBA
GO:0016020	Component	Membrane	IEA
GO:0019814	Component	Immunoglobulin complex	IBA
GO:0042101	Component	T cell receptor complex	IEA
GO:0042287	Function	MHC protein binding	NAS	6440030
GO:0042605	Function	Peptide antigen binding	NAS	6440030

MIM	HGNC	e!Ensembl
HGNC	N/A	TRAV19

A0A0A6YYK7

Protein name

T cell receptor alpha variable 19 (T-cell receptor alpha chain V region HPB-MLT)

Protein function

V region of the variable domain of T cell receptor (TR) alpha chain that participates in the antigen recognition (PubMed:24600447). Alpha-beta T cell receptors are antigen specific receptors which are essential to the immune response and are pre

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	26 → 116	Immunoglobulin V-set domain	Domain

Sequence

MLTASLLRAVIASICVVSSMAQKVTQAQTEISVVEKEDVTLDCVYETRDTTYYLFWYKQP
PSGELVFLIRRNSFDEQNEISGRYSWNFQKSTSSFNFTITASQVVDSAVYFCALSE

Sequence length

116

Interactions

View interactions

Related Genes Genes most often co-reported with TRAV19 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for TRAV19.

Diseases Linked via Similar Genes Diseases curated for genes most similar to TRAV19 (see Related Genes above), that are NOT already directly curated for TRAV19 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to TRAV19.

TRAV19 (T cell receptor alpha variable 19)

Bookmark This Gene