TRAV16 (T cell receptor alpha variable 16)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 28667 |
| Gene name | T cell receptor alpha variable 16 |
| Gene symbol | TRAV16 |
| Synonyms (NCBI Gene) |
TCRAV16S1TCRAV9S1
|
| Chromosome | 14 |
| Chromosome location | 14q11.2 |
| Summary | T cell receptors recognize foreign antigens which have been processed as small peptides and bound to major histocompatibility complex (MHC) molecules at the surface of antigen presenting cells (APC). Each T cell receptor is a dimer consisting of one alpha |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
|
|||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|||||||||||
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
A0A0A6YYK6 | ||||||||||
| Protein name | T cell receptor alpha variable 16 | ||||||||||
| Protein function | V region of the variable domain of T cell receptor (TR) alpha chain that participates in the antigen recognition (PubMed:24600447). Alpha-beta T cell receptors are antigen specific receptors which are essential to the immune response and are pre | ||||||||||
| Family and domains |
Pfam
|
||||||||||
| Sequence |
MKPTLISVLVIIFILRGTRAQRVTQPEKLLSVFKGAPVELKCNYSYSGSPELFWYVQYSR |
||||||||||
| Sequence length | 109 | ||||||||||
| Interactions | View interactions | ||||||||||
|
Related Genes
Genes most often co-reported with TRAV16 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to TRAV16 (see Related Genes above), that are NOT already directly curated for TRAV16 itself -- a lead worth checking, not a confirmed association.
0
|
|