Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	7187
Gene name	TNF receptor associated factor 3
Gene symbol	TRAF3
Synonyms (NCBI Gene)	CAP-1CAP1CD40bpCRAF1IIAE5IMD132AIMD132BLAP1RNF118
Chromosome	14
Chromosome location	14q32.32
Summary	The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from, members of the TNF receptor (TNFR) superfamily. This protein participates in

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs143813189	C>T	Risk-factor, likely-benign	Coding sequence variant, missense variant

359

Show/Hide all (359)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006827	hsa-miR-32-5p	Luciferase reporter assay	22709905
MIRT006827	hsa-miR-32-5p	Luciferase reporter assay	22709905
MIRT028936	hsa-miR-26b-5p	Microarray	19088304
MIRT568696	hsa-miR-662	HITS-CLIP	23824327
MIRT568695	hsa-miR-4286	HITS-CLIP	23824327
MIRT568693	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT568692	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT568691	hsa-miR-4455	HITS-CLIP	23824327
MIRT568690	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT568696	hsa-miR-662	PAR-CLIP	20371350
MIRT568695	hsa-miR-4286	PAR-CLIP	20371350
MIRT568694	hsa-miR-4694-5p	PAR-CLIP	20371350
MIRT568693	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT568692	hsa-miR-129-5p	PAR-CLIP	20371350
MIRT568691	hsa-miR-4455	PAR-CLIP	20371350
MIRT568690	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT486131	hsa-miR-6746-5p	PAR-CLIP	23592263
MIRT486129	hsa-miR-4707-3p	PAR-CLIP	23592263
MIRT486128	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT486127	hsa-miR-8085	PAR-CLIP	23592263
MIRT486126	hsa-miR-3191-3p	PAR-CLIP	23592263
MIRT568695	hsa-miR-4286	HITS-CLIP	28735896
MIRT568695	hsa-miR-4286	HITS-CLIP	28735896
MIRT734857	hsa-miR-153-3p	RNA-seq	33491670
MIRT735174	hsa-miR-214-3p	Western blottingqRT-PCRELISA	32670749
MIRT737231	hsa-miR-1307-5p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)ImmunofluorescenceqRT-PCRIn situ hybridization	33061854
MIRT568696	hsa-miR-662	HITS-CLIP	23824327
MIRT568695	hsa-miR-4286	HITS-CLIP	23824327
MIRT568693	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT568692	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT568691	hsa-miR-4455	HITS-CLIP	23824327
MIRT568690	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT568696	hsa-miR-662	PAR-CLIP	20371350
MIRT568695	hsa-miR-4286	PAR-CLIP	20371350
MIRT568694	hsa-miR-4694-5p	PAR-CLIP	20371350
MIRT568693	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT568692	hsa-miR-129-5p	PAR-CLIP	20371350
MIRT568691	hsa-miR-4455	PAR-CLIP	20371350
MIRT568690	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT486131	hsa-miR-6746-5p	PAR-CLIP	23592263
MIRT486129	hsa-miR-4707-3p	PAR-CLIP	23592263
MIRT486128	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT486127	hsa-miR-8085	PAR-CLIP	23592263
MIRT486126	hsa-miR-3191-3p	PAR-CLIP	23592263
MIRT756227	hsa-miR-95-3p	Luciferase reporter assayWestern blottingqRT-PCR	36727735
MIRT1450740	hsa-miR-1291	CLIP-seq
MIRT1450741	hsa-miR-1303	CLIP-seq
MIRT1450742	hsa-miR-146b-3p	CLIP-seq
MIRT1450743	hsa-miR-1915	CLIP-seq
MIRT1450744	hsa-miR-198	CLIP-seq
MIRT1450745	hsa-miR-3143	CLIP-seq
MIRT1450746	hsa-miR-3153	CLIP-seq
MIRT1450747	hsa-miR-329	CLIP-seq
MIRT1450748	hsa-miR-3613-3p	CLIP-seq
MIRT1450749	hsa-miR-362-3p	CLIP-seq
MIRT1450750	hsa-miR-3692	CLIP-seq
MIRT1450751	hsa-miR-3714	CLIP-seq
MIRT1450752	hsa-miR-3918	CLIP-seq
MIRT1450753	hsa-miR-3973	CLIP-seq
MIRT1450754	hsa-miR-4434	CLIP-seq
MIRT1450755	hsa-miR-4516	CLIP-seq
MIRT1450756	hsa-miR-4531	CLIP-seq
MIRT1450757	hsa-miR-4534	CLIP-seq
MIRT1450758	hsa-miR-4679	CLIP-seq
MIRT1450759	hsa-miR-4680-3p	CLIP-seq
MIRT1450760	hsa-miR-4685-5p	CLIP-seq
MIRT1450761	hsa-miR-4706	CLIP-seq
MIRT1450762	hsa-miR-4726-3p	CLIP-seq
MIRT1450763	hsa-miR-4728-3p	CLIP-seq
MIRT1450764	hsa-miR-4728-5p	CLIP-seq
MIRT1450765	hsa-miR-4749-5p	CLIP-seq
MIRT1450766	hsa-miR-4755-3p	CLIP-seq
MIRT1450767	hsa-miR-4768-3p	CLIP-seq
MIRT1450768	hsa-miR-4781-5p	CLIP-seq
MIRT1450769	hsa-miR-548a-5p	CLIP-seq
MIRT1450770	hsa-miR-548ab	CLIP-seq
MIRT1450771	hsa-miR-548ak	CLIP-seq
MIRT1450772	hsa-miR-548an	CLIP-seq
MIRT1450773	hsa-miR-548b-5p	CLIP-seq
MIRT1450774	hsa-miR-548c-5p	CLIP-seq
MIRT1450775	hsa-miR-548d-5p	CLIP-seq
MIRT1450776	hsa-miR-548h	CLIP-seq
MIRT1450777	hsa-miR-548i	CLIP-seq
MIRT1450778	hsa-miR-548j	CLIP-seq
MIRT1450779	hsa-miR-548w	CLIP-seq
MIRT1450780	hsa-miR-548y	CLIP-seq
MIRT1450781	hsa-miR-559	CLIP-seq
MIRT1450782	hsa-miR-607	CLIP-seq
MIRT1450783	hsa-miR-628-5p	CLIP-seq
MIRT1450784	hsa-miR-648	CLIP-seq
MIRT1450785	hsa-miR-665	CLIP-seq
MIRT1450786	hsa-miR-744	CLIP-seq
MIRT1450787	hsa-miR-933	CLIP-seq
MIRT1450788	hsa-miR-103a	CLIP-seq
MIRT1450789	hsa-miR-107	CLIP-seq
MIRT1450790	hsa-miR-1233	CLIP-seq
MIRT1450791	hsa-miR-1254	CLIP-seq
MIRT1450792	hsa-miR-1265	CLIP-seq
MIRT1450793	hsa-miR-128	CLIP-seq
MIRT1450794	hsa-miR-1285	CLIP-seq
MIRT1450795	hsa-miR-1290	CLIP-seq
MIRT1450740	hsa-miR-1291	CLIP-seq
MIRT1450796	hsa-miR-129-3p	CLIP-seq
MIRT1450797	hsa-miR-137	CLIP-seq
MIRT1450798	hsa-miR-139-5p	CLIP-seq
MIRT1450742	hsa-miR-146b-3p	CLIP-seq
MIRT1450799	hsa-miR-148a	CLIP-seq
MIRT1450800	hsa-miR-148b	CLIP-seq
MIRT1450801	hsa-miR-149	CLIP-seq
MIRT1450802	hsa-miR-152	CLIP-seq
MIRT1450803	hsa-miR-191	CLIP-seq
MIRT1450743	hsa-miR-1915	CLIP-seq
MIRT1450804	hsa-miR-1972	CLIP-seq
MIRT1450805	hsa-miR-214	CLIP-seq
MIRT1450806	hsa-miR-2355-3p	CLIP-seq
MIRT1450807	hsa-miR-2392	CLIP-seq
MIRT1450808	hsa-miR-27a	CLIP-seq
MIRT1450809	hsa-miR-27b	CLIP-seq
MIRT1450810	hsa-miR-299-3p	CLIP-seq
MIRT1450811	hsa-miR-3064-5p	CLIP-seq
MIRT1450812	hsa-miR-3116	CLIP-seq
MIRT1450813	hsa-miR-3120-3p	CLIP-seq
MIRT1450814	hsa-miR-3121-5p	CLIP-seq
MIRT1450815	hsa-miR-3127-3p	CLIP-seq
MIRT1450816	hsa-miR-3140-5p	CLIP-seq
MIRT1450817	hsa-miR-3145-5p	CLIP-seq
MIRT1450746	hsa-miR-3153	CLIP-seq
MIRT1450818	hsa-miR-3187-5p	CLIP-seq
MIRT1450819	hsa-miR-3194-3p	CLIP-seq
MIRT1450820	hsa-miR-3194-5p	CLIP-seq
MIRT1450821	hsa-miR-3607-3p	CLIP-seq
MIRT1450822	hsa-miR-3619-5p	CLIP-seq
MIRT1450823	hsa-miR-3667-3p	CLIP-seq
MIRT1450824	hsa-miR-3686	CLIP-seq
MIRT1450751	hsa-miR-3714	CLIP-seq
MIRT1450752	hsa-miR-3918	CLIP-seq
MIRT1450825	hsa-miR-3944-5p	CLIP-seq
MIRT1450826	hsa-miR-3960	CLIP-seq
MIRT1450753	hsa-miR-3973	CLIP-seq
MIRT1450827	hsa-miR-412	CLIP-seq
MIRT1450828	hsa-miR-4270	CLIP-seq
MIRT1450829	hsa-miR-4271	CLIP-seq
MIRT1450830	hsa-miR-4293	CLIP-seq
MIRT1450831	hsa-miR-4305	CLIP-seq
MIRT1450832	hsa-miR-4441	CLIP-seq
MIRT1450833	hsa-miR-4469	CLIP-seq
MIRT1450834	hsa-miR-4477b	CLIP-seq
MIRT1450835	hsa-miR-4479	CLIP-seq
MIRT1450836	hsa-miR-4511	CLIP-seq
MIRT1450837	hsa-miR-4646-3p	CLIP-seq
MIRT1450838	hsa-miR-4652-3p	CLIP-seq
MIRT1450758	hsa-miR-4679	CLIP-seq
MIRT1450760	hsa-miR-4685-5p	CLIP-seq
MIRT1450839	hsa-miR-4687-3p	CLIP-seq
MIRT1450840	hsa-miR-4696	CLIP-seq
MIRT1450761	hsa-miR-4706	CLIP-seq
MIRT1450841	hsa-miR-4711-3p	CLIP-seq
MIRT1450842	hsa-miR-4711-5p	CLIP-seq
MIRT1450843	hsa-miR-4722-5p	CLIP-seq
MIRT1450844	hsa-miR-4725-3p	CLIP-seq
MIRT1450762	hsa-miR-4726-3p	CLIP-seq
MIRT1450845	hsa-miR-4727-5p	CLIP-seq
MIRT1450846	hsa-miR-4731-5p	CLIP-seq
MIRT1450765	hsa-miR-4749-5p	CLIP-seq
MIRT1450766	hsa-miR-4755-3p	CLIP-seq
MIRT1450847	hsa-miR-4760-3p	CLIP-seq
MIRT1450848	hsa-miR-4763-5p	CLIP-seq
MIRT1450849	hsa-miR-4764-5p	CLIP-seq
MIRT1450767	hsa-miR-4768-3p	CLIP-seq
MIRT1450850	hsa-miR-4769-3p	CLIP-seq
MIRT1450768	hsa-miR-4781-5p	CLIP-seq
MIRT1450851	hsa-miR-4794	CLIP-seq
MIRT1450852	hsa-miR-4798-3p	CLIP-seq
MIRT1450853	hsa-miR-499-3p	CLIP-seq
MIRT1450854	hsa-miR-499a-3p	CLIP-seq
MIRT1450855	hsa-miR-513a-5p	CLIP-seq
MIRT1450856	hsa-miR-520d-5p	CLIP-seq
MIRT1450857	hsa-miR-524-5p	CLIP-seq
MIRT1450858	hsa-miR-539	CLIP-seq
MIRT1450769	hsa-miR-548a-5p	CLIP-seq
MIRT1450770	hsa-miR-548ab	CLIP-seq
MIRT1450771	hsa-miR-548ak	CLIP-seq
MIRT1450772	hsa-miR-548an	CLIP-seq
MIRT1450859	hsa-miR-548b-3p	CLIP-seq
MIRT1450773	hsa-miR-548b-5p	CLIP-seq
MIRT1450774	hsa-miR-548c-5p	CLIP-seq
MIRT1450775	hsa-miR-548d-5p	CLIP-seq
MIRT1450776	hsa-miR-548h	CLIP-seq
MIRT1450777	hsa-miR-548i	CLIP-seq
MIRT1450778	hsa-miR-548j	CLIP-seq
MIRT1450779	hsa-miR-548w	CLIP-seq
MIRT1450780	hsa-miR-548y	CLIP-seq
MIRT1450860	hsa-miR-550a	CLIP-seq
MIRT1450781	hsa-miR-559	CLIP-seq
MIRT1450861	hsa-miR-576-3p	CLIP-seq
MIRT1450862	hsa-miR-596	CLIP-seq
MIRT1450863	hsa-miR-600	CLIP-seq
MIRT1450864	hsa-miR-612	CLIP-seq
MIRT1450865	hsa-miR-615-3p	CLIP-seq
MIRT1450866	hsa-miR-661	CLIP-seq
MIRT1450785	hsa-miR-665	CLIP-seq
MIRT1450867	hsa-miR-711	CLIP-seq
MIRT1450868	hsa-miR-761	CLIP-seq
MIRT1450869	hsa-miR-802	CLIP-seq
MIRT1450870	hsa-miR-885-3p	CLIP-seq
MIRT1450871	hsa-miR-1202	CLIP-seq
MIRT1450872	hsa-miR-2467-5p	CLIP-seq
MIRT1450873	hsa-miR-3163	CLIP-seq
MIRT1450820	hsa-miR-3194-5p	CLIP-seq
MIRT1450874	hsa-miR-340	CLIP-seq
MIRT1450875	hsa-miR-3616-5p	CLIP-seq
MIRT1450876	hsa-miR-3647-5p	CLIP-seq
MIRT1450877	hsa-miR-3972	CLIP-seq
MIRT1450833	hsa-miR-4469	CLIP-seq
MIRT1450878	hsa-miR-4474-3p	CLIP-seq
MIRT1450879	hsa-miR-4722-3p	CLIP-seq
MIRT1450880	hsa-miR-4740-3p	CLIP-seq
MIRT1450881	hsa-miR-4795-5p	CLIP-seq
MIRT1450882	hsa-miR-503	CLIP-seq
MIRT1450855	hsa-miR-513a-5p	CLIP-seq
MIRT1450883	hsa-miR-548ad	CLIP-seq
MIRT1450884	hsa-miR-573	CLIP-seq
MIRT1450885	hsa-miR-595	CLIP-seq
MIRT1450886	hsa-miR-644	CLIP-seq
MIRT1450887	hsa-miR-658	CLIP-seq
MIRT1450788	hsa-miR-103a	CLIP-seq
MIRT1450789	hsa-miR-107	CLIP-seq
MIRT2134739	hsa-miR-1184	CLIP-seq
MIRT2134740	hsa-miR-1205	CLIP-seq
MIRT2134741	hsa-miR-1226	CLIP-seq
MIRT2134742	hsa-miR-1244	CLIP-seq
MIRT1450793	hsa-miR-128	CLIP-seq
MIRT1450794	hsa-miR-1285	CLIP-seq
MIRT2134743	hsa-miR-1286	CLIP-seq
MIRT2134744	hsa-miR-1322	CLIP-seq
MIRT1450797	hsa-miR-137	CLIP-seq
MIRT1450799	hsa-miR-148a	CLIP-seq
MIRT1450800	hsa-miR-148b	CLIP-seq
MIRT1450802	hsa-miR-152	CLIP-seq
MIRT2134745	hsa-miR-153	CLIP-seq
MIRT2134746	hsa-miR-15a	CLIP-seq
MIRT2134747	hsa-miR-15b	CLIP-seq
MIRT2134748	hsa-miR-16	CLIP-seq
MIRT2134749	hsa-miR-1825	CLIP-seq
MIRT1450803	hsa-miR-191	CLIP-seq
MIRT1450743	hsa-miR-1915	CLIP-seq
MIRT2134750	hsa-miR-195	CLIP-seq
MIRT2134751	hsa-miR-199a-3p	CLIP-seq
MIRT2134752	hsa-miR-199b-3p	CLIP-seq
MIRT1450805	hsa-miR-214	CLIP-seq
MIRT1450808	hsa-miR-27a	CLIP-seq
MIRT1450809	hsa-miR-27b	CLIP-seq
MIRT2134753	hsa-miR-3129-5p	CLIP-seq
MIRT2134754	hsa-miR-3158-5p	CLIP-seq
MIRT1450818	hsa-miR-3187-5p	CLIP-seq
MIRT2134755	hsa-miR-338-3p	CLIP-seq
MIRT1450874	hsa-miR-340	CLIP-seq
MIRT1450822	hsa-miR-3619-5p	CLIP-seq
MIRT2134756	hsa-miR-3646	CLIP-seq
MIRT2134757	hsa-miR-3647-3p	CLIP-seq
MIRT2134758	hsa-miR-3662	CLIP-seq
MIRT1450823	hsa-miR-3667-3p	CLIP-seq
MIRT1450751	hsa-miR-3714	CLIP-seq
MIRT1450825	hsa-miR-3944-5p	CLIP-seq
MIRT2134759	hsa-miR-424	CLIP-seq
MIRT2134760	hsa-miR-4267	CLIP-seq
MIRT1450831	hsa-miR-4305	CLIP-seq
MIRT1450754	hsa-miR-4434	CLIP-seq
MIRT2134761	hsa-miR-4436b-3p	CLIP-seq
MIRT2134762	hsa-miR-4443	CLIP-seq
MIRT2134763	hsa-miR-4457	CLIP-seq
MIRT2134764	hsa-miR-4468	CLIP-seq
MIRT1450833	hsa-miR-4469	CLIP-seq
MIRT2134765	hsa-miR-450b-5p	CLIP-seq
MIRT1450755	hsa-miR-4516	CLIP-seq
MIRT2134766	hsa-miR-4530	CLIP-seq
MIRT1450756	hsa-miR-4531	CLIP-seq
MIRT2134767	hsa-miR-4643	CLIP-seq
MIRT2134768	hsa-miR-4646-5p	CLIP-seq
MIRT2134769	hsa-miR-4676-5p	CLIP-seq
MIRT2134770	hsa-miR-4693-3p	CLIP-seq
MIRT2134771	hsa-miR-4700-3p	CLIP-seq
MIRT1450842	hsa-miR-4711-5p	CLIP-seq
MIRT2134772	hsa-miR-4715-3p	CLIP-seq
MIRT1450843	hsa-miR-4722-5p	CLIP-seq
MIRT1450762	hsa-miR-4726-3p	CLIP-seq
MIRT1450846	hsa-miR-4731-5p	CLIP-seq
MIRT2134773	hsa-miR-4733-3p	CLIP-seq
MIRT2134774	hsa-miR-4766-5p	CLIP-seq
MIRT1450767	hsa-miR-4768-3p	CLIP-seq
MIRT2134775	hsa-miR-486-3p	CLIP-seq
MIRT2134776	hsa-miR-497	CLIP-seq
MIRT2134777	hsa-miR-5095	CLIP-seq
MIRT2134778	hsa-miR-5096	CLIP-seq
MIRT1450855	hsa-miR-513a-5p	CLIP-seq
MIRT2134779	hsa-miR-513b	CLIP-seq
MIRT2134780	hsa-miR-521	CLIP-seq
MIRT1450858	hsa-miR-539	CLIP-seq
MIRT2134781	hsa-miR-542-3p	CLIP-seq
MIRT2134782	hsa-miR-544	CLIP-seq
MIRT2134783	hsa-miR-550b	CLIP-seq
MIRT2134784	hsa-miR-556-5p	CLIP-seq
MIRT2134785	hsa-miR-570	CLIP-seq
MIRT2134786	hsa-miR-575	CLIP-seq
MIRT1450863	hsa-miR-600	CLIP-seq
MIRT1450864	hsa-miR-612	CLIP-seq
MIRT2134787	hsa-miR-642b	CLIP-seq
MIRT2134788	hsa-miR-718	CLIP-seq
MIRT1450868	hsa-miR-761	CLIP-seq
MIRT1450869	hsa-miR-802	CLIP-seq
MIRT1450798	hsa-miR-139-5p	CLIP-seq
MIRT2356025	hsa-miR-147	CLIP-seq
MIRT2356026	hsa-miR-1911	CLIP-seq
MIRT2356027	hsa-miR-224	CLIP-seq
MIRT1450817	hsa-miR-3145-5p	CLIP-seq
MIRT2356028	hsa-miR-3185	CLIP-seq
MIRT2356029	hsa-miR-33a	CLIP-seq
MIRT2356030	hsa-miR-33b	CLIP-seq
MIRT2356031	hsa-miR-4738-3p	CLIP-seq
MIRT1450767	hsa-miR-4768-3p	CLIP-seq
MIRT2356032	hsa-miR-510	CLIP-seq
MIRT1450856	hsa-miR-520d-5p	CLIP-seq
MIRT2356033	hsa-miR-520g	CLIP-seq
MIRT2356034	hsa-miR-520h	CLIP-seq
MIRT1450857	hsa-miR-524-5p	CLIP-seq
MIRT2356035	hsa-miR-581	CLIP-seq
MIRT1450863	hsa-miR-600	CLIP-seq
MIRT2356036	hsa-miR-616	CLIP-seq
MIRT2356037	hsa-miR-892a	CLIP-seq
MIRT1450788	hsa-miR-103a	CLIP-seq
MIRT1450789	hsa-miR-107	CLIP-seq
MIRT1450798	hsa-miR-139-5p	CLIP-seq
MIRT2462272	hsa-miR-4304	CLIP-seq
MIRT2462273	hsa-miR-451b	CLIP-seq
MIRT1450856	hsa-miR-520d-5p	CLIP-seq
MIRT1450857	hsa-miR-524-5p	CLIP-seq
MIRT1450863	hsa-miR-600	CLIP-seq
MIRT2649500	hsa-miR-1207-3p	CLIP-seq
MIRT2649501	hsa-miR-1470	CLIP-seq
MIRT2649502	hsa-miR-4283	CLIP-seq
MIRT1450833	hsa-miR-4469	CLIP-seq
MIRT2649503	hsa-miR-4489	CLIP-seq
MIRT2649504	hsa-miR-4492	CLIP-seq
MIRT2649505	hsa-miR-4498	CLIP-seq
MIRT2649506	hsa-miR-4667-3p	CLIP-seq
MIRT2649507	hsa-miR-4690-3p	CLIP-seq
MIRT1450846	hsa-miR-4731-5p	CLIP-seq
MIRT2649508	hsa-miR-762	CLIP-seq
MIRT2649509	hsa-miR-766	CLIP-seq
MIRT2694024	hsa-miR-1182	CLIP-seq
MIRT2694025	hsa-miR-193a-5p	CLIP-seq
MIRT2694026	hsa-miR-2114	CLIP-seq
MIRT2694027	hsa-miR-3127-5p	CLIP-seq
MIRT2694028	hsa-miR-3182	CLIP-seq
MIRT2694029	hsa-miR-3660	CLIP-seq
MIRT2694030	hsa-miR-4256	CLIP-seq
MIRT2694031	hsa-miR-4526	CLIP-seq
MIRT1450766	hsa-miR-4755-3p	CLIP-seq
MIRT2694032	hsa-miR-554	CLIP-seq

Show/Hide all (70)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	NAS	21200404
GO:0001817	Process	Regulation of cytokine production	IEA
GO:0001817	Process	Regulation of cytokine production	ISS
GO:0002224	Process	Toll-like receptor signaling pathway	IDA	18222170
GO:0002224	Process	Toll-like receptor signaling pathway	IEA
GO:0002224	Process	Toll-like receptor signaling pathway	ISS
GO:0002376	Process	Immune system process	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	19898473
GO:0004842	Function	Ubiquitin-protein transferase activity	TAS
GO:0005164	Function	Tumor necrosis factor receptor binding	IEA
GO:0005164	Function	Tumor necrosis factor receptor binding	IPI	11728344
GO:0005515	Function	Protein binding	IPI	7527023, 10791955, 12005438, 12270937, 14743216, 15280356, 19419966, 19893624, 20080758, 20138174, 20174559, 20732415, 21903422, 23153539, 23333941, 23871208, 25241761, 27135603, 27387501, 27980081, 28514442, 30561431, 30833792, 31980649, 32296183, 32514408, 32707033, 33372174, 3396
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IC	16858409
GO:0005739	Component	Mitochondrion	IDA	19898473
GO:0005739	Component	Mitochondrion	IEA
GO:0005768	Component	Endosome	IDA	18222170
GO:0005768	Component	Endosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	10799510
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	7530216
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0008063	Process	Toll signaling pathway	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0009299	Process	MRNA transcription	IDA	9891032
GO:0009898	Component	Cytoplasmic side of plasma membrane	IBA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	ISS
GO:0010008	Component	Endosome membrane	IDA	18222170
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019903	Function	Protein phosphatase binding	IPI	23871208
GO:0030162	Process	Regulation of proteolysis	IEA
GO:0030162	Process	Regulation of proteolysis	IMP	20185819
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	11279055
GO:0031996	Function	Thioesterase binding	IEA
GO:0031996	Function	Thioesterase binding	IPI	11279055
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IMP	20185819
GO:0032479	Process	Regulation of type I interferon production	IEA
GO:0032481	Process	Positive regulation of type I interferon production	IDA	14703513, 25636800, 29441066, 32130408
GO:0032481	Process	Positive regulation of type I interferon production	IDA	19898473
GO:0032648	Process	Regulation of interferon-beta production	IEA
GO:0032648	Process	Regulation of interferon-beta production	ISS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IMP	20185819
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	25636800, 28747347
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	18222170
GO:0035591	Function	Signaling adaptor activity	IBA
GO:0035631	Component	CD40 receptor complex	IEA
GO:0035631	Component	CD40 receptor complex	ISS
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	TAS
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	IBA
GO:0045087	Process	Innate immune response	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050688	Process	Regulation of defense response to virus	IEA
GO:0050688	Process	Regulation of defense response to virus	ISS
GO:0051607	Process	Defense response to virus	NAS	24622840, 25847972
GO:0060337	Process	Type I interferon-mediated signaling pathway	NAS	25847972
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	19898473
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0140374	Process	Antiviral innate immune response	IDA	9891032, 14703513
GO:1902554	Component	Serine/threonine protein kinase complex	NAS	24622840

MIM	HGNC	e!Ensembl
601896	12033	ENSG00000131323

Q13114

Protein name

TNF receptor-associated factor 3 (EC 2.3.2.27) (CD40 receptor-associated factor 1) (CRAF1) (CD40-binding protein) (CD40BP) (LMP1-associated protein 1) (LAP1) (RING-type E3 ubiquitin transferase TRAF3)

Protein function

Cytoplasmic E3 ubiquitin ligase that regulates various signaling pathways, such as the NF-kappa-B, mitogen-activated protein kinase (MAPK) and interferon regulatory factor (IRF) pathways, and thus controls a lot of biological processes in both i

PDB

1FLK , 1FLL , 1KZZ , 1L0A , 1RF3 , 1ZMS , 2ECY , 2GKW , 8T5P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02176	zf-TRAF	136 → 192	TRAF-type zinc finger	Family
PF02176	zf-TRAF	192 → 251	TRAF-type zinc finger	Family

Sequence

MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVL
CSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNE
SRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHC
KSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV
FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNR
VTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRG
EYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQ
TVLENGTYIKDDTIFIKVIVDTSDLPDP

Sequence length

568

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Herpes simplex encephalitis, susceptibility to, 3	Pathogenic	rs2542619877	RCV004566621	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
TRAF3 haploinsufficiency	Pathogenic	rs2542634545	RCV003325323	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
TRAF3-related disorder	Pathogenic	rs2542619877	RCV004759418	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (26)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANXIETY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLELITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ependymoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 132A	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immunodeficiency 132b	Uncertain significance	ClinVar ClinVar, HPO ClinVar, HPO	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multisystem inflammatory syndrome in children	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SIALOLITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (117)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute pancreatitis	Pancreatitis	BEFREE	28988112, 30055802, 30497068, 31402118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	19540595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	20643858	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	36253437	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	29693188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	19074733		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	12220533, 25468570, 26755589, 29296923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	19770515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	29196212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28071724		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	19825990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	12220533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26981887, 32579175, 34745496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	28753533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	25425325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	28753533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	28753533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31803230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31803230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	GWASCAT_DG	30929738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	31539122	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholecystitis	Cholecystitis	BEFREE	30692554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholecystitis	Cholecystitis	Pubtator	30692554	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	30692554		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholelithiasis	Cholecystolithiasis	Pubtator	30692554	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	BEFREE	23329887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	23329887	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	23329887	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34257589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital contractural arachnodactyly	Pubtator	31539122	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	26034202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28479387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	23329887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	23329887	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30909133, 31322228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	33901562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	35142878	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28479387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	25468570, 25921526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystonia Disorders	Dystonia	BEFREE	19651773, 25425325, 25461922, 26596547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal Dysplasia	LHGDN	12270937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	28185403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	26882989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	31589164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	30692554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	30692554	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gerstmann-Straussler-Scheinker Disease	Gerstmann-Straussler-Scheinker syndrome	BEFREE	30692554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29693188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	28295216, 29921694	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	26034202		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin Disease	Hodgkin Disease	BEFREE	11023520, 11144929, 19540595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	11023520, 22469134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37005320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	11023520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	11023520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	23329887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	23329887	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	27026631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	16569346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10595933, 26308964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	18607851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	32132867	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26919710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25965830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11600226, 24131623, 25200342, 26740054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	12471121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	15514968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	24131623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	14521460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	14521460, 19656130	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28071724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	30692554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31016787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30226589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19074733, 26755589, 29296923, 29921694, 31501481, 31826940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31803230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	29765142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	28682481, 29765142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	17692804, 17692805, 21228035, 24987674, 26036313, 28234347	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	17692805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	19074733, 20053756, 21228035, 24131623, 24987674, 25200342, 26036313, 29296923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	21228035	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	24076602		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31039804		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	31039804, 34488019	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Muscular Dystrophy	Muscular dystrophy	BEFREE	24055652, 26596547, 30723199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	34279044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	10225457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28098136	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12147741, 12738714, 19074733, 20386466, 24131623, 25200342, 25468570, 28295222, 29853604, 29921694, 30226589, 30319624, 30323820, 30687320, 31501481, 31826940, 9580648 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31408437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	36253437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	31322228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	19770515, 30323820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30323820, 31243287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis, Age-Related	Osteoporosis	BEFREE	31243287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis, Senile	Osteoporosis	BEFREE	31243287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	2496060, 30178836	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30178836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	28185403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	29921694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30323820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	24509444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19074733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29921694	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35634245, 37523561, 9392004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28295222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	26882989, 31408437, 31589164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30226589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35851310	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	28753533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	12509453, 8751579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35631261, 37093683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	23329887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	30622699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	19351844	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
X-Linked Emery-Dreifuss Muscular Dystrophy	Emery-Dreifuss Muscular Dystrophy, X-Linked	BEFREE	25461922		★★★★★ ★☆☆☆☆ Found in Text Mining only

TRAF3 (TNF receptor associated factor 3)