TPTE2P1 (TPTE2 pseudogene 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 646405
Gene name TPTE2 pseudogene 1
Gene symbol TPTE2P1
Synonyms (NCBI Gene)
-
Chromosome 13
Chromosome location 13q12.13
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 35196 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5T6R2
Protein name Putative phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2P1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10409 PTEN_C2 16 → 74 C2 domain of PTEN tumour-suppressor protein Domain
Sequence 
MPAAFPCVFPPQSLQVFPQMIVKVWEKQSLPLPGLRGSPVERLYLPRNELDNPHKQKAWK
IYPPEFAVEILFGMVSVDSLLFVLSSPHWWLHLAQGSFWMSEGGFSLCHPGWSVVAQSLL
TSTSAFCVRAILLPQPPE
Sequence length 138
Interactions View interactions

No strongly related genes found yet for TPTE2P1.

No additional diseases found yet through genes similar to TPTE2P1.