TPST1 (tyrosylprotein sulfotransferase 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 8460
• Gene name: Tyrosylprotein sulfotransferase 1
• Gene symbol: TPST1
• Synonyms (NCBI Gene): TANGO13A
• Chromosome: 7
• Chromosome location: 7q11.21

miRNA Show/Hide all (26)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022966	hsa-miR-124-3p	Microarray	18668037
MIRT2134647	hsa-miR-4496	CLIP-seq
MIRT2649389	hsa-miR-3691-3p	CLIP-seq
MIRT2649390	hsa-miR-3925-5p	CLIP-seq
MIRT2649391	hsa-miR-4311	CLIP-seq
MIRT2649392	hsa-miR-4428	CLIP-seq
MIRT2649393	hsa-miR-4661-3p	CLIP-seq
MIRT2649394	hsa-miR-4700-3p	CLIP-seq
MIRT2649395	hsa-miR-4714-3p	CLIP-seq
MIRT2649396	hsa-miR-495	CLIP-seq
MIRT2649397	hsa-miR-5095	CLIP-seq
MIRT2649398	hsa-miR-570	CLIP-seq
MIRT2649399	hsa-miR-598	CLIP-seq
MIRT2649400	hsa-miR-600	CLIP-seq
MIRT2649401	hsa-miR-607	CLIP-seq
MIRT2649389	hsa-miR-3691-3p	CLIP-seq
MIRT2649392	hsa-miR-4428	CLIP-seq
MIRT2649393	hsa-miR-4661-3p	CLIP-seq
MIRT2649394	hsa-miR-4700-3p	CLIP-seq
MIRT2649395	hsa-miR-4714-3p	CLIP-seq
MIRT2649396	hsa-miR-495	CLIP-seq
MIRT2649397	hsa-miR-5095	CLIP-seq
MIRT2649398	hsa-miR-570	CLIP-seq
MIRT2649399	hsa-miR-598	CLIP-seq
MIRT2649400	hsa-miR-600	CLIP-seq
MIRT2649401	hsa-miR-607	CLIP-seq

Gene ontology (GO) Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IDA	16859706
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005796	Component	Golgi lumen	IEA
GO:0005802	Component	Trans-Golgi network	IEA
GO:0008476	Function	Protein-tyrosine sulfotransferase activity	IBA
GO:0008476	Function	Protein-tyrosine sulfotransferase activity	IDA	9501187
GO:0008476	Function	Protein-tyrosine sulfotransferase activity	IEA
GO:0008476	Function	Protein-tyrosine sulfotransferase activity	TAS	9733778
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9501187
GO:0016740	Function	Transferase activity	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	28821720
GO:0043687	Process	Post-translational protein modification	IDA	9501187
GO:0043687	Process	Post-translational protein modification	IEA
GO:0050427	Process	3'-phosphoadenosine 5'-phosphosulfate metabolic process	IEA
GO:0050427	Process	3'-phosphoadenosine 5'-phosphosulfate metabolic process	TAS

Other IDs

• MIM: 603125
• HGNC: 12020
• e!Ensembl: ENSG00000169902

Protein

• UniProt ID: O60507
• Protein name: Protein-tyrosine sulfotransferase 1 (EC 2.8.2.20) (Tyrosylprotein sulfotransferase 1) (TPST-1)
• Protein function: Catalyzes the O-sulfation of tyrosine residues within acidic motifs of polypeptides, using 3'-phosphoadenylyl sulfate (PAPS) as cosubstrate.
• PDB: 5WRI , 5WRJ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13469	Sulfotransfer_3	70 → 263		Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:9501187}.
• Sequence:

  MVGKLKQNLLLACLVISSVTVFYLGQHAMECHHRIEERSQPVKLESTRTTVRTGLDLKAN
  KTFAYHKDMPLIFIGGVPRSGTTLMRAMLDAHPDIRCGEETRVIPRILALKQMWSRSSKE
  KIRLDEAGVTDEVLDSAMQAFLLEIIVKHGEPAPYLCNKDPFALKSLTYLSRLFPNAKFL
  LMVRDGRASVHSMISRKVTIAGFDLNSYRDCLTKWNRAIETMYNQCMEVGYKKCMLVHYE
  QLVLHPERWMRTLLKFLQIPWNHSVLHHEEMIGKAGGVSLSKVERSTDQVIKPVNVGALS
  KWVGKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKPDPKIIENTRRVYKGEFQLPDFL
  KEKPQTEQVE

• Sequence length: 370

Pathways

Reactome Pathway:

Cytosolic sulfonation of small molecules

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	35663546	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	22179738	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	38469033	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (13)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17082220, 36969166	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASCAT_DG	22179738		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	39893495	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26238632		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25079514		★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASCAT_DG	22179738		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	36035368	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26238632		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	23472069	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26238632		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	39893495	Associate	★☆☆☆☆ Found in Text Mining only
Shwachman syndrome	Shwachman Syndrome	BEFREE	12032733		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	31333338, 35127296, 35958598, 39368544	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for TPST1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to TPST1.