TPSG1 (tryptase gamma 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 25823
Gene name Tryptase gamma 1
Gene symbol TPSG1
Synonyms (NCBI Gene)
PRSS31TMTtrpA
Chromosome 16
Chromosome location 16p13.3
Summary Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes ar
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT021578 hsa-miR-142-3p Microarray 17612493
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004252 Function Serine-type endopeptidase activity IBA
GO:0004252 Function Serine-type endopeptidase activity IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005615 Component Extracellular space IBA
GO:0005886 Component Plasma membrane TAS 10521469
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
609341 14134 ENSG00000116176
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NRR2
Protein name Tryptase gamma (EC 3.4.21.-) (Serine protease 31) (Transmembrane tryptase) [Cleaved into: Tryptase gamma light chain; Tryptase gamma heavy chain]
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00089 Trypsin 38 → 265 Trypsin Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in many tissues.
Sequence 
MALGACGLLLLLAVPGVSLRTLQPGCGRPQVSDAGGRIVGGHAAPAGAWPWQASLRLRRM
HVCGGSLLSPQWVLTAAHCFSGSLNSSDYQVHLGELEITLSPHFSTVRQIILHSSPSGQP
GTSGDIALVELSVPVTLSSRILPVCLPEASDDFCPGIRCWVTGWGYTREGEPLPPPYSLR
EVKVSVVDTETCRRDYPGPGGSILQPDMLCARGPGDACQDDSGGPLVCQVNGAWVQAGTV
SWGEGCGRPNRPGVYTRVPAYVNWIRRHITASGGSESGYPRLPLLAGLFLPGLFLLLVSC
VLLAKCLLHPSADGTPFPAPD
Sequence length 321
Interactions View interactions

No strongly related genes found yet for TPSG1.

No additional diseases found yet through genes similar to TPSG1.