TPRX1 (tetrapeptide repeat homeobox 1) | GeDiPNet

GeDiPNet

Log in to bookmark this gene

Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	284355
Gene name	Tetrapeptide repeat homeobox 1
Gene symbol	TPRX1
Synonyms (NCBI Gene)	TPRX
Chromosome	19
Chromosome location	19q13.33
Summary	Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is a member of the TPRX homeo

20 Show/Hide all (20)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1450374	hsa-miR-103a	CLIP-seq
MIRT1450375	hsa-miR-107	CLIP-seq
MIRT1450376	hsa-miR-1184	CLIP-seq
MIRT1450377	hsa-miR-214	CLIP-seq
MIRT1450378	hsa-miR-3065-5p	CLIP-seq
MIRT1450379	hsa-miR-3185	CLIP-seq
MIRT1450380	hsa-miR-3619-5p	CLIP-seq
MIRT1450381	hsa-miR-4269	CLIP-seq
MIRT1450382	hsa-miR-4511	CLIP-seq
MIRT1450383	hsa-miR-548aa	CLIP-seq
MIRT1450384	hsa-miR-555	CLIP-seq
MIRT1450385	hsa-miR-761	CLIP-seq
MIRT2693996	hsa-miR-1226	CLIP-seq
MIRT2693997	hsa-miR-224	CLIP-seq
MIRT2693998	hsa-miR-3935	CLIP-seq
MIRT2693999	hsa-miR-4280	CLIP-seq
MIRT2694000	hsa-miR-4519	CLIP-seq
MIRT2694001	hsa-miR-4530	CLIP-seq
MIRT2694002	hsa-miR-4733-3p	CLIP-seq
MIRT2694003	hsa-miR-634	CLIP-seq

9 Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	36074823
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0160021	Process	Maternal-to-zygotic transition of gene expression	IDA	36074823

MIM	HGNC	e!Ensembl
611166	32174	ENSG00000178928

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q8N7U7
Protein name	Tetra-peptide repeat homeobox protein 1
Protein function	Transcription factor expressed after fertilization required for zygotic genome activation (ZGA), a critical event in early embryonic development during which the developmental control passes from maternally provided mRNAs to the expression of th
Family and domains
Sequence	MLSLREQQLQVWFKNRRAKLARERRLQQQPQRVPGQRGRGARAAPLVPAASASAPQRGPS GILPAAEPTICSLHQAWGGPGCRAQKGIPAALSPGPGPIPAPIPGPAQIPGPLPGSIPGP IPGPAQIPSPIPAPIPGPISGPVQIPGPFRGPIPGPISGPAPIPGPISGPFSGPNPGPIP GPNPGPIPGPISGPIPGPISVPIPGPIPGPISGPISGPNPGPIPGPIPGPISGPNPGPIP GPISGPNPGLIPGPIPGPISGPGPIIGPIPSPAQIPGPGRLQGPGPILSPGRMRSPGSLP GLAPILGPGSGPGSGSVPAPIPGPGSLPAPAPLWPQSPDASDFLPDTQLFPHFTELLLPL DPLEGSSVSTMTSQYQEGDDSMGKKHSGSQPQEEGGSVNENHSGPRLLLDL
Sequence length	411
Interactions	View interactions