Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	285386
Gene name	Tumor protein p63 regulated 1
Gene symbol	TPRG1
Synonyms (NCBI Gene)	FAM79B
Chromosome	3
Chromosome location	3q28

87 Show/Hide all (87)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021515	hsa-miR-145-5p	Reporter assay;Microarray	21351259
MIRT756348	hsa-miR-129-5p	Western blottingqRT-PCR	37294527
MIRT1450212	hsa-miR-103a	CLIP-seq
MIRT1450213	hsa-miR-107	CLIP-seq
MIRT1450214	hsa-miR-1200	CLIP-seq
MIRT1450215	hsa-miR-1303	CLIP-seq
MIRT1450216	hsa-miR-1305	CLIP-seq
MIRT1450217	hsa-miR-132	CLIP-seq
MIRT1450218	hsa-miR-136	CLIP-seq
MIRT1450219	hsa-miR-144	CLIP-seq
MIRT1450220	hsa-miR-15a	CLIP-seq
MIRT1450221	hsa-miR-15b	CLIP-seq
MIRT1450222	hsa-miR-16	CLIP-seq
MIRT1450223	hsa-miR-195	CLIP-seq
MIRT1450224	hsa-miR-212	CLIP-seq
MIRT1450225	hsa-miR-214	CLIP-seq
MIRT1450226	hsa-miR-219-1-3p	CLIP-seq
MIRT1450227	hsa-miR-24	CLIP-seq
MIRT1450228	hsa-miR-298	CLIP-seq
MIRT1450229	hsa-miR-3065-3p	CLIP-seq
MIRT1450230	hsa-miR-3065-5p	CLIP-seq
MIRT1450231	hsa-miR-3074-5p	CLIP-seq
MIRT1450232	hsa-miR-31	CLIP-seq
MIRT1450233	hsa-miR-3123	CLIP-seq
MIRT1450234	hsa-miR-3124-3p	CLIP-seq
MIRT1450235	hsa-miR-3125	CLIP-seq
MIRT1450236	hsa-miR-3161	CLIP-seq
MIRT1450237	hsa-miR-3619-5p	CLIP-seq
MIRT1450238	hsa-miR-3682-3p	CLIP-seq
MIRT1450239	hsa-miR-369-3p	CLIP-seq
MIRT1450240	hsa-miR-374c	CLIP-seq
MIRT1450241	hsa-miR-383	CLIP-seq
MIRT1450242	hsa-miR-3916	CLIP-seq
MIRT1450243	hsa-miR-3921	CLIP-seq
MIRT1450244	hsa-miR-3925-5p	CLIP-seq
MIRT1450245	hsa-miR-424	CLIP-seq
MIRT1450246	hsa-miR-4269	CLIP-seq
MIRT1450247	hsa-miR-4291	CLIP-seq
MIRT1450248	hsa-miR-4310	CLIP-seq
MIRT1450249	hsa-miR-4324	CLIP-seq
MIRT1450250	hsa-miR-4432	CLIP-seq
MIRT1450251	hsa-miR-4438	CLIP-seq
MIRT1450252	hsa-miR-4446-3p	CLIP-seq
MIRT1450253	hsa-miR-4514	CLIP-seq
MIRT1450254	hsa-miR-4522	CLIP-seq
MIRT1450255	hsa-miR-4536	CLIP-seq
MIRT1450256	hsa-miR-4649-3p	CLIP-seq
MIRT1450257	hsa-miR-4653-5p	CLIP-seq
MIRT1450258	hsa-miR-4656	CLIP-seq
MIRT1450259	hsa-miR-4682	CLIP-seq
MIRT1450260	hsa-miR-4692	CLIP-seq
MIRT1450261	hsa-miR-4714-5p	CLIP-seq
MIRT1450262	hsa-miR-4721	CLIP-seq
MIRT1450263	hsa-miR-4729	CLIP-seq
MIRT1450264	hsa-miR-4742-5p	CLIP-seq
MIRT1450265	hsa-miR-4766-5p	CLIP-seq
MIRT1450266	hsa-miR-4772-5p	CLIP-seq
MIRT1450267	hsa-miR-4778-3p	CLIP-seq
MIRT1450268	hsa-miR-497	CLIP-seq
MIRT1450269	hsa-miR-499-5p	CLIP-seq
MIRT1450270	hsa-miR-539	CLIP-seq
MIRT1450271	hsa-miR-544b	CLIP-seq
MIRT1450272	hsa-miR-571	CLIP-seq
MIRT1450273	hsa-miR-579	CLIP-seq
MIRT1450274	hsa-miR-587	CLIP-seq
MIRT1450275	hsa-miR-655	CLIP-seq
MIRT1450276	hsa-miR-761	CLIP-seq
MIRT1450277	hsa-miR-922	CLIP-seq
MIRT1450278	hsa-miR-924	CLIP-seq
MIRT2134567	hsa-miR-1297	CLIP-seq
MIRT2134568	hsa-miR-26a	CLIP-seq
MIRT2134569	hsa-miR-26b	CLIP-seq
MIRT2134570	hsa-miR-4465	CLIP-seq
MIRT2134571	hsa-miR-548t	CLIP-seq
MIRT2355884	hsa-miR-21	CLIP-seq
MIRT2355885	hsa-miR-3153	CLIP-seq
MIRT2355886	hsa-miR-4668-5p	CLIP-seq
MIRT2355887	hsa-miR-548an	CLIP-seq
MIRT2355888	hsa-miR-590-5p	CLIP-seq
MIRT2355889	hsa-miR-635	CLIP-seq
MIRT1450278	hsa-miR-924	CLIP-seq
MIRT2649385	hsa-miR-3163	CLIP-seq
MIRT1450250	hsa-miR-4432	CLIP-seq
MIRT2649386	hsa-miR-4760-5p	CLIP-seq
MIRT1450269	hsa-miR-499-5p	CLIP-seq
MIRT2649387	hsa-miR-513a-3p	CLIP-seq
MIRT2649388	hsa-miR-577	CLIP-seq

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q6ZUI0

Protein name

Tumor protein p63-regulated gene 1 protein (Protein FAM79B)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12456	hSac2	65 → 172	Inositol phosphatase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the epidermal layer of the skin. {ECO:0000269|PubMed:18256694}.

Sequence

MSTIGSFEGFQAVSLKQEGDDQPSETDHLSMEEEDPMPRQISRQSSVTESTLYPNPYHQP
YISRKYFATRPGAIETAMEDLKGHVAETSGETIQGFWLLTKIDHWNNEKERILLVTDKTL
LICKYDFIMLSCVQLQRIPLSAVYRICLGKFTFPGMSLDKRQGEGLRIYWGSPEEQSLLS
RWNPWSTEVPYATFTEHPMKYTSEKFLEICKLSGFMSKLVPAIQNAHKNSTGSGRGKKLM
VLTEPILIETYTGLMSFIGNRNKLGYSLARGSIGF

Sequence length

275

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (15)
COLOR VISION DISORDER	—	GWAS catalog	37359372	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS SQUAMOUS CELL CARCINOMA	—	GWAS catalog	32041948, 38182794	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	31326317, 32889700, 34594039, 35915169, 37340002, 40783572	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	34594039, 35915169, 37340002, 40783572	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	34594039, 35915169, 37340002, 40783572	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SMALL CELL LUNG CARCINOMA	—	GWAS catalog	26829030, 31326317	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASM	—	GWAS catalog	35121771	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	40021644	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	38469033	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	36333501	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEBORRHEIC KERATOSIS	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	26829030, 34594039, 35915169, 37340002, 39024449, 40783572	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	26829030, 31326317	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	38162683	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	30961553	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	BEFREE	19963137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple	Lipomatosis	BEFREE	19963137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37481637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TPRG1 (tumor protein p63 regulated 1)

Bookmark This Gene