TOMM20L (translocase of outer mitochondrial membrane 20 like)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 387990
• Gene name: Translocase of outer mitochondrial membrane 20 like
• Gene symbol: TOMM20L
• Synonyms (NCBI Gene): UNQ9438
• Chromosome: 14
• Chromosome location: 14q23.1

Gene ontology (GO) Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005742	Component	Mitochondrial outer membrane translocase complex	IBA
GO:0005742	Component	Mitochondrial outer membrane translocase complex	IEA
GO:0006605	Process	Protein targeting	IEA
GO:0006886	Process	Intracellular protein transport	IEA
GO:0008320	Function	Protein transmembrane transporter activity	IBA
GO:0016020	Component	Membrane	IEA
GO:0016031	Process	TRNA import into mitochondrion	IBA
GO:0030150	Process	Protein import into mitochondrial matrix	IBA
GO:0030943	Function	Mitochondrion targeting sequence binding	IBA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q6UXN7
• Protein name: TOMM20-like protein 1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02064	MAS20	14 → 128	MAS20 protein import receptor	Family

• Sequence:

  MPSVRSLLRLLAAAAACGAFAFLGYCIYLNRKRRGDPAFKRRLRDKRRAEPQKAEEQGTQ
  LWDPTKNKKLQELFLQEVRMGELWLSRGEHRMGIQHLGNALLVCEQPRELLKVFKHTLPP
  KVFEMLLHKIPLICQQFEADMNEQDCLEDDPD

• Sequence length: 152

Pathways

KEGG Pathway:

Mitophagy - animal

Related Genes

No strongly related genes found yet for TOMM20L.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to TOMM20L.