TNXA (tenascin XA (pseudogene))

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 7146
Gene name Tenascin XA (pseudogene)
Gene symbol TNXA
Synonyms (NCBI Gene)
D6S103EHXBLTNXXA
Chromosome 6
Chromosome location 6p21.33
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0070062 Component Extracellular exosome HDA 23533145
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 11975 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q16473
Protein name Putative tenascin-XA (TN-XA)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00041 fn3 45 → 125 Fibronectin type III domain Domain
PF00041 fn3 144 → 229 Fibronectin type III domain Domain
PF00041 fn3 245 → 306 Fibronectin type III domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the adrenal gland. {ECO:0000269|PubMed:1373808}.
Sequence 
MEDKNGAPHGAPHSDSPLGFSHAAPEEDTPAPELAPEAPEPPEEPRLGVLTVTDTTPDSM
RLSWSVAQGPFDSFVVQYEDTNGQPQALLVDGDQSKILISGLEPSTPYRFLLYGLHEGKR
LGPLSAEGTTGLAPAGQTSEESRPRLSQLSVTDVTTSSLRLNWEAPPGAFDSFLLRFGVP
SPSTLEPHPRPLLQRELMVPGTRHSAVLRDLRSGTLYSLTLYGLRGPHKADSIQGTARTL
SPVLESPRDLQFSEIRETSAKVNWMPPPSRADSFKVSYQLADGGEPQSVQVDGRARTQKL
QFLTVPHSCVH
Sequence length 311
Interactions View interactions

No strongly related genes found yet for TNXA.

No additional diseases found yet through genes similar to TNXA.