TNP1 (transition protein 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 7141
• Gene name: Transition protein 1
• Gene symbol: TNP1
• Synonyms (NCBI Gene): TP1
• Chromosome: 2
• Chromosome location: 2q35
• Summary: Transition protein-1 is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines (see PRM1, MIM 182880; PRM2, MIM 182890) (Luerssen et al., 1990 [PubMed 2249851]).[supplied by O

miRNA Show/Hide all (10)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025822	hsa-miR-7-5p	Microarray	17612493
MIRT2354028	hsa-miR-2110	CLIP-seq
MIRT2354029	hsa-miR-3147	CLIP-seq
MIRT2354030	hsa-miR-3148	CLIP-seq
MIRT2354031	hsa-miR-3150a-3p	CLIP-seq
MIRT2354032	hsa-miR-4271	CLIP-seq
MIRT2354033	hsa-miR-4425	CLIP-seq
MIRT2354034	hsa-miR-4668-5p	CLIP-seq
MIRT2354035	hsa-miR-4725-3p	CLIP-seq
MIRT2354036	hsa-miR-4781-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000012	Process	Single strand break repair	IDA	12743712
GO:0000786	Component	Nucleosome	IBA
GO:0000786	Component	Nucleosome	IDA	12743712
GO:0000786	Component	Nucleosome	IEA
GO:0000786	Component	Nucleosome	ISS
GO:0001673	Component	Male germ cell nucleus	IBA
GO:0001673	Component	Male germ cell nucleus	IEA
GO:0003677	Function	DNA binding	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	IMP	12743712
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005694	Component	Chromosome	IEA
GO:0006337	Process	Nucleosome disassembly	IMP	10781074
GO:0006338	Process	Chromatin remodeling	IBA
GO:0006338	Process	Chromatin remodeling	IDA	12743712
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007286	Process	Spermatid development	IDA	12743712
GO:0007289	Process	Spermatid nucleus differentiation	TAS	12743712
GO:0007290	Process	Spermatid nucleus elongation	IBA
GO:0007290	Process	Spermatid nucleus elongation	IMP	10781074
GO:0010954	Process	Positive regulation of protein processing	IEA
GO:0010954	Process	Positive regulation of protein processing	ISS
GO:0019953	Process	Sexual reproduction	IMP	10781074
GO:0030154	Process	Cell differentiation	IEA
GO:0030317	Process	Flagellated sperm motility	IMP	10781074
GO:0031507	Process	Heterochromatin formation	IEP	11315969
GO:0035041	Process	Sperm DNA decondensation	TAS	12743712
GO:0035092	Process	Sperm DNA condensation	IEA
GO:0035092	Process	Sperm DNA condensation	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	12743712

Other IDs

• MIM: 190231
• HGNC: 11951
• e!Ensembl: ENSG00000118245

Protein

• UniProt ID: P09430
• Protein name: Spermatid nuclear transition protein 1 (STP-1) (TP-1)
• Protein function: Plays a key role in the replacement of histones to protamine in the elongating spermatids of mammals. In condensing spermatids, loaded onto the nucleosomes, where it promotes the recruitment and processing of protamines, which are responsible fo
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02079	TP1	2 → 52	Nuclear transition protein 1	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed by spermatids (at protein level). {ECO:0000269|PubMed:9809674}.
• Sequence:

  MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL

• Sequence length: 55

Related Genes

No strongly related genes found yet for TNP1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to TNP1.