TNMD (tenomodulin)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 64102
Gene name Tenomodulin
Gene symbol TNMD
Synonyms (NCBI Gene)
BRICD4CHM1LTEM
Chromosome X
Chromosome location Xq22.1
Summary This gene encodes a protein that is related to chondromodulin-I, which is a cartilage-specific glycoprotein that functions to stimulate chondrocyte growth and to inhibit tube formation of endothelial cells. This protein is also an angiogenesis inhibitor.
miRNA miRNA information provided by mirtarbase database.
4
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT2353980 hsa-miR-3125 CLIP-seq
MIRT2353981 hsa-miR-3916 CLIP-seq
MIRT2353982 hsa-miR-4709-3p CLIP-seq
MIRT2353983 hsa-miR-4773 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001886 Process Endothelial cell morphogenesis IEA
GO:0001937 Process Negative regulation of endothelial cell proliferation IBA
GO:0001937 Process Negative regulation of endothelial cell proliferation IEA
GO:0005515 Function Protein binding IPI 25416956, 31515488, 32296183, 32814053
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300459 17757 ENSG00000000005
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H2S6
Protein name Tenomodulin (TeM) (hTeM) (Chondromodulin-1-like protein) (ChM1L) (hChM1L) (Chondromodulin-I-like protein) (Myodulin) (Tendin)
Protein function May be an angiogenesis inhibitor.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04089 BRICHOS 95 → 185 BRICHOS domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in hypovascular connective tissues such as tendons. Also has strong expression in adipose tissue. {ECO:0000269|PubMed:19602561, ECO:0000269|PubMed:19780194, ECO:0000269|PubMed:22700804}.
Sequence 
MAKNPPENCEDCHILNAEAFKSKKICKSLKICGLVFGILALTLIVLFWGSKHFWPEVPKK
AYDMEHTFYSNGEKKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKC
FIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDN
VTMYWINPTLISVSELQDFEEEGEDLHFPANEKKGIEQNEQWVVPQVKVEKTRHARQASE
EELPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVIC
RVIMPCNWWVARMLGRV
Sequence length 317
Interactions View interactions

No strongly related genes found yet for TNMD.

No additional diseases found yet through genes similar to TNMD.