TNFSF4 (TNF superfamily member 4)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 7292
• Gene name: TNF superfamily member 4
• Gene symbol: TNFSF4
• Synonyms (NCBI Gene): CD134L, CD252, GP34, OX-40L, OX4OL, TNLG2B, TXGP1
• Chromosome: 1
• Chromosome location: 1q25.1
• Summary: This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene h

miRNA Show/Hide all (310)

miRTarBase ID	miRNA	Experiments	Reference
MIRT615655	hsa-miR-8485	HITS-CLIP	23824327
MIRT670334	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT670333	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT670332	hsa-miR-603	HITS-CLIP	23824327
MIRT670331	hsa-miR-3941	HITS-CLIP	23824327
MIRT615655	hsa-miR-8485	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT615655	hsa-miR-8485	HITS-CLIP	23824327
MIRT670334	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT670333	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT670332	hsa-miR-603	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT670331	hsa-miR-3941	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT615655	hsa-miR-8485	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT615655	hsa-miR-8485	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT615655	hsa-miR-8485	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT670334	hsa-miR-329-3p	HITS-CLIP	27418678
MIRT670334	hsa-miR-329-3p	HITS-CLIP	27418678
MIRT670334	hsa-miR-329-3p	HITS-CLIP	27418678
MIRT670334	hsa-miR-329-3p	HITS-CLIP	27418678
MIRT670333	hsa-miR-362-3p	HITS-CLIP	27418678
MIRT670333	hsa-miR-362-3p	HITS-CLIP	27418678
MIRT670333	hsa-miR-362-3p	HITS-CLIP	27418678
MIRT670333	hsa-miR-362-3p	HITS-CLIP	27418678
MIRT670331	hsa-miR-3941	HITS-CLIP	27418678
MIRT670331	hsa-miR-3941	HITS-CLIP	27418678
MIRT670331	hsa-miR-3941	HITS-CLIP	27418678
MIRT670331	hsa-miR-3941	HITS-CLIP	27418678
MIRT670332	hsa-miR-603	HITS-CLIP	27418678
MIRT670332	hsa-miR-603	HITS-CLIP	27418678
MIRT670332	hsa-miR-603	HITS-CLIP	27418678
MIRT670332	hsa-miR-603	HITS-CLIP	27418678
MIRT615655	hsa-miR-8485	HITS-CLIP	27418678
MIRT615655	hsa-miR-8485	HITS-CLIP	27418678
MIRT615655	hsa-miR-8485	HITS-CLIP	27418678
MIRT615655	hsa-miR-8485	HITS-CLIP	27418678
MIRT615655	hsa-miR-8485	HITS-CLIP	23824327
MIRT670334	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT670333	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT670332	hsa-miR-603	HITS-CLIP	23824327
MIRT670331	hsa-miR-3941	HITS-CLIP	23824327
MIRT615655	hsa-miR-8485	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT615655	hsa-miR-8485	HITS-CLIP	23824327
MIRT670334	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT670333	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT670332	hsa-miR-603	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT670331	hsa-miR-3941	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT615655	hsa-miR-8485	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT615655	hsa-miR-8485	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT615655	hsa-miR-8485	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT1443526	hsa-miR-10a	CLIP-seq
MIRT1443527	hsa-miR-10b	CLIP-seq
MIRT1443528	hsa-miR-1255a	CLIP-seq
MIRT1443529	hsa-miR-1255b	CLIP-seq
MIRT1443530	hsa-miR-125a-5p	CLIP-seq
MIRT1443531	hsa-miR-125b	CLIP-seq
MIRT1443532	hsa-miR-1273f	CLIP-seq
MIRT1443533	hsa-miR-141	CLIP-seq
MIRT1443534	hsa-miR-143	CLIP-seq
MIRT1443535	hsa-miR-145	CLIP-seq
MIRT1443536	hsa-miR-186	CLIP-seq
MIRT1443537	hsa-miR-1972	CLIP-seq
MIRT1443538	hsa-miR-198	CLIP-seq
MIRT1443539	hsa-miR-200a	CLIP-seq
MIRT1443540	hsa-miR-2278	CLIP-seq
MIRT1443541	hsa-miR-2682	CLIP-seq
MIRT1443542	hsa-miR-27a	CLIP-seq
MIRT1443543	hsa-miR-27b	CLIP-seq
MIRT1443544	hsa-miR-2964a-5p	CLIP-seq
MIRT1443545	hsa-miR-3120-5p	CLIP-seq
MIRT1443546	hsa-miR-3133	CLIP-seq
MIRT1443547	hsa-miR-3152-5p	CLIP-seq
MIRT1443548	hsa-miR-3177-5p	CLIP-seq
MIRT1443549	hsa-miR-329	CLIP-seq
MIRT1443550	hsa-miR-3605-5p	CLIP-seq
MIRT1443551	hsa-miR-3908	CLIP-seq
MIRT1443552	hsa-miR-4310	CLIP-seq
MIRT1443553	hsa-miR-4319	CLIP-seq
MIRT1443554	hsa-miR-4324	CLIP-seq
MIRT1443555	hsa-miR-4421	CLIP-seq
MIRT1443556	hsa-miR-4459	CLIP-seq
MIRT1443557	hsa-miR-449c	CLIP-seq
MIRT1443558	hsa-miR-4652-3p	CLIP-seq
MIRT1443559	hsa-miR-4690-5p	CLIP-seq
MIRT1443560	hsa-miR-4708-5p	CLIP-seq
MIRT1443561	hsa-miR-4722-5p	CLIP-seq
MIRT1443562	hsa-miR-4747-5p	CLIP-seq
MIRT1443563	hsa-miR-4770	CLIP-seq
MIRT1443564	hsa-miR-4774-3p	CLIP-seq
MIRT1443565	hsa-miR-513a-5p	CLIP-seq
MIRT1443566	hsa-miR-522	CLIP-seq
MIRT1443567	hsa-miR-634	CLIP-seq
MIRT1443568	hsa-miR-764	CLIP-seq
MIRT1443569	hsa-miR-940	CLIP-seq
MIRT2132730	hsa-miR-1252	CLIP-seq
MIRT2132731	hsa-miR-216b	CLIP-seq
MIRT2132732	hsa-miR-224	CLIP-seq
MIRT2132733	hsa-miR-339-5p	CLIP-seq
MIRT2132734	hsa-miR-3606	CLIP-seq
MIRT2132735	hsa-miR-3611	CLIP-seq
MIRT2132736	hsa-miR-4287	CLIP-seq
MIRT2132737	hsa-miR-4420	CLIP-seq
MIRT2132738	hsa-miR-4469	CLIP-seq
MIRT2132739	hsa-miR-4685-3p	CLIP-seq
MIRT2132740	hsa-miR-4713-5p	CLIP-seq
MIRT2132741	hsa-miR-4786-3p	CLIP-seq
MIRT2353818	hsa-miR-101	CLIP-seq
MIRT1443549	hsa-miR-329	CLIP-seq
MIRT2132734	hsa-miR-3606	CLIP-seq
MIRT2132741	hsa-miR-4786-3p	CLIP-seq
MIRT2353819	hsa-miR-586	CLIP-seq
MIRT2396138	hsa-miR-219-5p	CLIP-seq
MIRT2396139	hsa-miR-4782-3p	CLIP-seq
MIRT2396140	hsa-miR-483-3p	CLIP-seq
MIRT2396141	hsa-miR-578	CLIP-seq
MIRT2441449	hsa-miR-1270	CLIP-seq
MIRT2441450	hsa-miR-1299	CLIP-seq
MIRT2441451	hsa-miR-4290	CLIP-seq
MIRT2441452	hsa-miR-4683	CLIP-seq
MIRT2441453	hsa-miR-4687-5p	CLIP-seq
MIRT2441454	hsa-miR-4782-5p	CLIP-seq
MIRT2441455	hsa-miR-516b	CLIP-seq
MIRT2441456	hsa-miR-620	CLIP-seq
MIRT2462104	hsa-miR-103b	CLIP-seq
MIRT1443549	hsa-miR-329	CLIP-seq
MIRT2462105	hsa-miR-376c	CLIP-seq
MIRT2647893	hsa-miR-122	CLIP-seq
MIRT2132730	hsa-miR-1252	CLIP-seq
MIRT1443528	hsa-miR-1255a	CLIP-seq
MIRT1443529	hsa-miR-1255b	CLIP-seq
MIRT2441449	hsa-miR-1270	CLIP-seq
MIRT2647894	hsa-miR-1273g	CLIP-seq
MIRT2441450	hsa-miR-1299	CLIP-seq
MIRT2647895	hsa-miR-138	CLIP-seq
MIRT2647896	hsa-miR-147	CLIP-seq
MIRT2647897	hsa-miR-153	CLIP-seq
MIRT2647898	hsa-miR-188-5p	CLIP-seq
MIRT1443537	hsa-miR-1972	CLIP-seq
MIRT1443538	hsa-miR-198	CLIP-seq
MIRT1443540	hsa-miR-2278	CLIP-seq
MIRT2647899	hsa-miR-2467-3p	CLIP-seq
MIRT2647900	hsa-miR-2467-5p	CLIP-seq
MIRT1443541	hsa-miR-2682	CLIP-seq
MIRT1443545	hsa-miR-3120-5p	CLIP-seq
MIRT2647901	hsa-miR-3134	CLIP-seq
MIRT1443547	hsa-miR-3152-5p	CLIP-seq
MIRT2647902	hsa-miR-3160-3p	CLIP-seq
MIRT1443548	hsa-miR-3177-5p	CLIP-seq
MIRT2647903	hsa-miR-3188	CLIP-seq
MIRT2647904	hsa-miR-3202	CLIP-seq
MIRT1443549	hsa-miR-329	CLIP-seq
MIRT2132733	hsa-miR-339-5p	CLIP-seq
MIRT2647905	hsa-miR-3591-5p	CLIP-seq
MIRT1443550	hsa-miR-3605-5p	CLIP-seq
MIRT2132734	hsa-miR-3606	CLIP-seq
MIRT2647906	hsa-miR-3617	CLIP-seq
MIRT2647907	hsa-miR-3678-3p	CLIP-seq
MIRT1443551	hsa-miR-3908	CLIP-seq
MIRT2647908	hsa-miR-3911	CLIP-seq
MIRT2647909	hsa-miR-3915	CLIP-seq
MIRT2647910	hsa-miR-3928	CLIP-seq
MIRT2647911	hsa-miR-3975	CLIP-seq
MIRT2647912	hsa-miR-4280	CLIP-seq
MIRT2441451	hsa-miR-4290	CLIP-seq
MIRT1443552	hsa-miR-4310	CLIP-seq
MIRT2647913	hsa-miR-4316	CLIP-seq
MIRT1443555	hsa-miR-4421	CLIP-seq
MIRT2647914	hsa-miR-4426	CLIP-seq
MIRT1443556	hsa-miR-4459	CLIP-seq
MIRT2647915	hsa-miR-4476	CLIP-seq
MIRT1443557	hsa-miR-449c	CLIP-seq
MIRT2647916	hsa-miR-4533	CLIP-seq
MIRT2647917	hsa-miR-4534	CLIP-seq
MIRT2647918	hsa-miR-4633-3p	CLIP-seq
MIRT2647919	hsa-miR-4647	CLIP-seq
MIRT1443558	hsa-miR-4652-3p	CLIP-seq
MIRT2647920	hsa-miR-4662b	CLIP-seq
MIRT2441452	hsa-miR-4683	CLIP-seq
MIRT2441453	hsa-miR-4687-5p	CLIP-seq
MIRT1443559	hsa-miR-4690-5p	CLIP-seq
MIRT2647921	hsa-miR-4719	CLIP-seq
MIRT1443561	hsa-miR-4722-5p	CLIP-seq
MIRT1443562	hsa-miR-4747-5p	CLIP-seq
MIRT1443564	hsa-miR-4774-3p	CLIP-seq
MIRT2647922	hsa-miR-4777-5p	CLIP-seq
MIRT2441454	hsa-miR-4782-5p	CLIP-seq
MIRT2132741	hsa-miR-4786-3p	CLIP-seq
MIRT2647923	hsa-miR-4786-5p	CLIP-seq
MIRT2647924	hsa-miR-4789-3p	CLIP-seq
MIRT2647925	hsa-miR-4802-3p	CLIP-seq
MIRT2647926	hsa-miR-485-5p	CLIP-seq
MIRT2441455	hsa-miR-516b	CLIP-seq
MIRT2647927	hsa-miR-518d-5p	CLIP-seq
MIRT2647928	hsa-miR-519b-5p	CLIP-seq
MIRT2647929	hsa-miR-519c-5p	CLIP-seq
MIRT2647930	hsa-miR-520c-5p	CLIP-seq
MIRT2647931	hsa-miR-526a	CLIP-seq
MIRT2647932	hsa-miR-548q	CLIP-seq
MIRT2441456	hsa-miR-620	CLIP-seq
MIRT1443567	hsa-miR-634	CLIP-seq
MIRT2647933	hsa-miR-641	CLIP-seq
MIRT2647934	hsa-miR-644	CLIP-seq
MIRT1443568	hsa-miR-764	CLIP-seq
MIRT2647935	hsa-miR-769-5p	CLIP-seq
MIRT1443569	hsa-miR-940	CLIP-seq
MIRT1443538	hsa-miR-198	CLIP-seq
MIRT2647909	hsa-miR-3915	CLIP-seq
MIRT2647910	hsa-miR-3928	CLIP-seq
MIRT2647914	hsa-miR-4426	CLIP-seq
MIRT2647919	hsa-miR-4647	CLIP-seq
MIRT2647920	hsa-miR-4662b	CLIP-seq
MIRT2647921	hsa-miR-4719	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HDAC11	Activation	21239696

Gene ontology (GO) Show/Hide all (56)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0001819	Process	Positive regulation of cytokine production	IBA
GO:0002215	Process	Defense response to nematode	ISS
GO:0002526	Process	Acute inflammatory response	ISS
GO:0002639	Process	Positive regulation of immunoglobulin production	ISS
GO:0002726	Process	Positive regulation of T cell cytokine production	ISS
GO:0002819	Process	Regulation of adaptive immune response	ISS
GO:0002830	Process	Positive regulation of type 2 immune response	ISS
GO:0002891	Process	Positive regulation of immunoglobulin mediated immune response	ISS
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	TAS	7913952
GO:0005125	Function	Cytokine activity	IEA
GO:0005164	Function	Tumor necrosis factor receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	16905106
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	17166734
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	NAS	18397322
GO:0005886	Component	Plasma membrane	TAS	7913952
GO:0006954	Process	Inflammatory response	IBA
GO:0006955	Process	Immune response	IEA
GO:0007154	Process	Cell communication	IEA
GO:0007165	Process	Signal transduction	TAS	7913952
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	7913952
GO:0009615	Process	Response to virus	ISS
GO:0009986	Component	Cell surface	IDA	18397322
GO:0016020	Component	Membrane	IEA
GO:0023052	Process	Signaling	IEA
GO:0032689	Process	Negative regulation of type II interferon production	ISS
GO:0032700	Process	Negative regulation of interleukin-17 production	IDA	18501882
GO:0032722	Process	Positive regulation of chemokine production	ISS
GO:0032729	Process	Positive regulation of type II interferon production	IDA	18501882
GO:0032733	Process	Positive regulation of interleukin-10 production	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	ISS
GO:0032736	Process	Positive regulation of interleukin-13 production	ISS
GO:0032753	Process	Positive regulation of interleukin-4 production	IDA	18501882
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	20844189
GO:0032813	Function	Tumor necrosis factor receptor superfamily binding	IBA
GO:0032813	Function	Tumor necrosis factor receptor superfamily binding	ISS
GO:0035709	Process	Memory T cell activation	ISS
GO:0035712	Process	T-helper 2 cell activation	ISS
GO:0035713	Process	Response to nitrogen dioxide	ISS
GO:0042102	Process	Positive regulation of T cell proliferation	IBA
GO:0043372	Process	Positive regulation of CD4-positive, alpha-beta T cell differentiation	ISS
GO:0043382	Process	Positive regulation of memory T cell differentiation	ISS
GO:0045590	Process	Negative regulation of regulatory T cell differentiation	ISS
GO:0045626	Process	Negative regulation of T-helper 1 cell differentiation	ISS
GO:0045630	Process	Positive regulation of T-helper 2 cell differentiation	ISS
GO:0046641	Process	Positive regulation of alpha-beta T cell proliferation	ISS
GO:0050727	Process	Regulation of inflammatory response	ISS
GO:0050729	Process	Positive regulation of inflammatory response	IDA	20844189
GO:0050871	Process	Positive regulation of B cell activation	ISS
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	20844189
GO:0071380	Process	Cellular response to prostaglandin E stimulus	IDA	19029446
GO:1900281	Process	Positive regulation of CD4-positive, alpha-beta T cell costimulation	ISS
GO:2000572	Process	Positive regulation of interleukin-4-dependent isotype switching to IgE isotypes	ISS

Other IDs

• MIM: 603594
• HGNC: 11934
• e!Ensembl: ENSG00000117586

Protein

• UniProt ID: P23510
• Protein name: Tumor necrosis factor ligand superfamily member 4 (Glycoprotein Gp34) (OX40 ligand) (OX40L) (TAX transcriptionally-activated glycoprotein 1) (CD antigen CD252)
• Protein function: Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.
• PDB: 2HEV
• Sequence:

  MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQ
  SIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQ
  KDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEF
  CVL

• Sequence length: 183

Pathways

KEGG Pathway:

Cytokine-cytokine receptor interaction

Reactome Pathway:

TNFs bind their physiological receptors

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (26)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ASTHMA	—	GWAS catalog	27182965, 29083406, 30929738, 31036433, 31361310, 31669095, 32296059, 34103634	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	31669095	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	35577104, 37794016, 38663478	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	CTD, Disgenet CTD, Disgenet	12031769	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	30929738, 31036433, 31669095	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	37359372	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	GWAS catalog	21441570	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	37337107	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	CTD, Disgenet CTD, Disgenet	18059267, 19838193	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	23412934	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION, SUSCEPTIBILITY TO	—	ClinVar, GenCC	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOSITIS	—	GWAS catalog	30573655	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY TYPE 1	—	Disgenet, Orphanet Disgenet, Orphanet	23459209	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY-CATAPLEXY SYNDROME	—	GWAS catalog	23459209, 37188663	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME	—	GWAS catalog	37120605	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	38469033	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	38965376	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	23143596, 24390342, 24532676, 30423114, 30573655, 33310728, 35470158, 36333501	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	CTD, GWAS catalog, Orphanet CTD, GWAS catalog, Orphanet CTD, GWAS catalog, Orphanet	18204446, 19838193, 19838195, 21905002, 22654485, 22820624, 22850862, 23273568, 23740937, 23943494, 24091983, 26502338, 26606652, 26663301, 27399966, 28714469, 30573655, 32771030, 33272962, 34076728, 36327221, 36750564, 38724181	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	GWAS catalog	23740937, 30573655, 31672989, 38296975	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRICUSPID VALVE DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	39379762	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (158)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	21111564, 21445270, 21476935		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	30300827		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30300827		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	21239696		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	27088737, 28214951, 28713926, 30454861, 30848348		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	37742913	Associate	★☆☆☆☆ Found in Text Mining only
Amnesia, Transient Global	Amnesia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	21111564		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30214685		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	15750594, 18285570, 18998106, 21445270, 21476935, 23184501, 24068192, 24163149, 26125814, 29921578		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	LHGDN	15750594		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	22847298		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	24532676, 25359291, 37457686	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	15100674, 18060034, 22948028, 27088737, 29024606, 29554934, 29940571, 30890137		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	15100674		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	20139223, 24851948, 33656624, 34103634	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASCAT_DG	31036433		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	18674748	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	15750594, 18285570, 18998106, 21445270, 21476935, 23184501, 24068192, 24163149, 26125814, 29921578		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	18674748, 21445270, 22870213, 24068192, 29921578, 30797237	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	19778912, 23635951, 23874208, 26215166, 28818832, 29032462, 29330050, 30468820, 30944836, 31704879		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	22870213, 28470010, 30797237, 30944836, 36389676	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	31704879		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	27872495, 29285231		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	27872495	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29207606		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22870213, 29949525, 31292534, 34545132, 35844785, 37643511	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37861541	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35936015	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29424751		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	31871930	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	BEFREE	18998106, 22870213		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	22870213	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	21393601, 30797237	Associate	★☆☆☆☆ Found in Text Mining only
Cataplexy	Cataplexy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	19589242, 23184501, 24163149, 24595151		★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral microangiopathy	Pubtator	30797237	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	18998106, 29424751		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	18998106, 29424751		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	30300827		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	GWASCAT_DG	31036433		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15536147		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	24583911		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	12223520, 30552020, 9886424		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	12118101		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26458736		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26872462	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	31783796	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	16329997, 16943719, 29424751, 31783796		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	16329997, 16943719, 29424751, 31783796		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	24699314, 31783796	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	16329997, 16943719, 29424751, 31783796		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	24851948, 32176307	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17016617		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28045060	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	31467932	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	31467932		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	33656624	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	20139223	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	23036746		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	33777009	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	8889553	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	25744203		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25744203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	22781551		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	28931653		★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	35896115	Associate	★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	27556446, 31704879		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	27556446	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	18674748	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	22870213	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	21239696		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	21239696	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	22891927		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type I	Hyperlipoproteinemia	BEFREE	23216302		★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	32176307	Associate	★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	23216302	Associate	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	27556446		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	27556446	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	20197421	Stimulate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	35769457	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	30944836		★☆☆☆☆ Found in Text Mining only
IMMUNODEFICIENCY 16	Immunodeficiency	BEFREE	23897980		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	19181384, 30760919		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	30689765	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	9886424		★☆☆☆☆ Found in Text Mining only
Intracranial Thrombosis	Intracranial thrombosis	Pubtator	30797237	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	18998106, 30797237		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	23897980		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	21719445, 23936824	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	23936824		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	14984494		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30500073, 36151238	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	14984494, 29321210, 30500073		★☆☆☆☆ Found in Text Mining only
Libman-Sacks Disease	Nonbacterial verrucal endocardiosis	CTD_human_DG	18059267, 19838193		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	31040163		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	21719445, 23936824		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19092840, 19357697, 19778912, 20169177, 20848568, 21719445, 21792837, 21905002, 22870213, 23874208, 23936824, 24699314, 25652333, 25890262, 26070486, 30568041, 31871930, 36189300	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	21719445, 23936824		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	CTD_human_DG	18059267, 19838193		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	19083191, 19092840, 19357697, 19778912, 20012871, 20947545, 21719445, 21905002, 22422496, 22820624, 22847298, 22850862, 22870213, 23936824, 25652333, 25890262, 27519474, 28696253, 28818832, 29032462, 30041578, 30468820, 30568041, 31032751, 31299880		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	ORPHANET_DG	19838193, 21905002, 22654485, 22820624, 22850862, 23943494, 24091983		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	BEFREE	18802705, 22847298, 23936824, 28696253, 31032751		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	23936824	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	21719445, 23936824		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	30626755		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29207606		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16001161, 22870213, 30563566, 31564917		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	17975660, 31501955		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	31501955	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	31501955		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	30723312		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	34282497	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	31181776	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myasthenia Gravis	Myasthenia Gravis	BEFREE	11071109		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	35265719	Associate	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	34830466	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	15750594, 16329997, 16943719, 18356244, 18398332, 18998106, 21445270, 21476935, 23184501, 26125814, 29921578		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	21445270, 29921578	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Narcolepsy	Narcolepsy	ORPHANET_DG	23459209		★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	BEFREE	23497937, 23725858		★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	Pubtator	32669953	Associate	★☆☆☆☆ Found in Text Mining only
Narcolepsy type 1	Narcolepsy	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Narcolepsy-Cataplexy Syndrome	Narcolepsy-Cataplexy Syndrome	ORPHANET_DG	23459209		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasal Polyps	Nasal polyposis	BEFREE	19951374, 20924287, 24583911, 30519393		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14984494, 17975660, 22781551, 24293009, 29118006, 30700577, 31501955, 31555511, 31564917		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	12771917	Associate	★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	29032462		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31555511		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34518312	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30214685		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	23622253		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31703602	Associate	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	23589118		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	25775429	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30624031		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	25652333, 28320444, 30468820		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis Allergic	Rhinitis	Pubtator	28713926	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	23897980	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	19778912, 22870213	Associate	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	34830466	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	29655283	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	30568041		★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	22870213		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32548602	Associate	★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	21111564		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35528617	Associate	★☆☆☆☆ Found in Text Mining only
Systemic lupus erythematosus	Systemic lupus erythematosus	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	BEFREE	19778912, 21187296, 22422496, 30619351		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Thymoma	BEFREE	11071109		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	27556446		★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	27556446	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36161312, 37924153	Associate	★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic syndrome	Pubtator	27872495	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

TNFSF15 2 shared diseasesNephrotic syndrome, Psychiatric disorders 2 shared pathwaysCytokine-cytokine receptor interaction, TNFs bind their physiological receptors 2 shared evidence sourcesGWAS catalog (Nephrotic syndrome), GWAS catalog (Psychiatric disorders) Related via 2 shared diseases including Nephrotic syndrome, Psychiatric disorders — evidence mostly GWAS catalog. TNFRSF8 2 shared diseasesDilated cardiomyopathy, Respiratory system disease 2 shared pathwaysCytokine-cytokine receptor interaction, TNFs bind their physiological receptors 3 shared evidence sourcesCTD (Dilated cardiomyopathy), Disgenet (Dilated cardiomyopathy), GWAS catalog (Respiratory system disease) Related via 2 shared diseases including Dilated cardiomyopathy, Respiratory system disease — evidence mostly CTD. TNFSF9 1 shared diseaseDilated cardiomyopathy 2 shared pathwaysCytokine-cytokine receptor interaction, TNFs bind their physiological receptors 2 shared evidence sourcesCTD (Dilated cardiomyopathy), Disgenet (Dilated cardiomyopathy) Related via 2 shared pathways including Cytokine-cytokine receptor interaction, TNFs bind their physiological receptors — evidence mostly CTD. CD27 1 shared diseaseDilated cardiomyopathy 2 shared pathwaysCytokine-cytokine receptor interaction, TNFs bind their physiological receptors 2 shared evidence sourcesCTD (Dilated cardiomyopathy), Disgenet (Dilated cardiomyopathy) Related via 2 shared pathways including Cytokine-cytokine receptor interaction, TNFs bind their physiological receptors — evidence mostly CTD. CD70 1 shared diseaseDilated cardiomyopathy 2 shared pathwaysCytokine-cytokine receptor interaction, TNFs bind their physiological receptors 2 shared evidence sourcesCTD (Dilated cardiomyopathy), Disgenet (Dilated cardiomyopathy) Related via 2 shared pathways including Cytokine-cytokine receptor interaction, TNFs bind their physiological receptors — evidence mostly CTD.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
TNFSF15	2	["Nephrotic syndrome","Psychiatric disorders"]	2	["Cytokine-cytokine receptor interaction","TNFs bind their physiological receptors"]	2	["GWAS catalog (Nephrotic syndrome)","GWAS catalog (Psychiatric disorders)"]
TNFRSF8	2	["Dilated cardiomyopathy","Respiratory system disease"]	2	["Cytokine-cytokine receptor interaction","TNFs bind their physiological receptors"]	3	["CTD (Dilated cardiomyopathy)","Disgenet (Dilated cardiomyopathy)","GWAS catalog (Respiratory system disease)"]
TNFSF9	1	["Dilated cardiomyopathy"]	2	["Cytokine-cytokine receptor interaction","TNFs bind their physiological receptors"]	2	["CTD (Dilated cardiomyopathy)","Disgenet (Dilated cardiomyopathy)"]
CD27	1	["Dilated cardiomyopathy"]	2	["Cytokine-cytokine receptor interaction","TNFs bind their physiological receptors"]	2	["CTD (Dilated cardiomyopathy)","Disgenet (Dilated cardiomyopathy)"]
CD70	1	["Dilated cardiomyopathy"]	2	["Cytokine-cytokine receptor interaction","TNFs bind their physiological receptors"]	2	["CTD (Dilated cardiomyopathy)","Disgenet (Dilated cardiomyopathy)"]

Diseases Linked via Similar Genes

Combined immunodeficiency disease Linked via 2 of 5 related genesCD27, CD70 Lymphoproliferative syndrome Linked via 2 of 5 related genesCD27, CD70 Ankylosing spondylitis Linked via 1 of 5 related genesTNFSF15 Autoimmune disease Linked via 1 of 5 related genesTNFSF15 Autoimmune thyroid disease Linked via 1 of 5 related genesTNFSF15

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Combined immunodeficiency disease	2	["CD27","CD70"]
Lymphoproliferative syndrome	2	["CD27","CD70"]
Ankylosing spondylitis	1	["TNFSF15"]
Autoimmune disease	1	["TNFSF15"]
Autoimmune thyroid disease	1	["TNFSF15"]