TMUB1 (transmembrane and ubiquitin like domain containing 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 83590
• Gene name: Transmembrane and ubiquitin like domain containing 1
• Gene symbol: TMUB1
• Synonyms (NCBI Gene): C7orf21, DULP, HOPS, SB144
• Chromosome: 7
• Chromosome location: 7q36.1

miRNA Show/Hide all (53)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050340	hsa-miR-25-3p	CLASH	23622248
MIRT049837	hsa-miR-92a-3p	CLASH	23622248
MIRT046628	hsa-miR-222-3p	CLASH	23622248
MIRT039677	hsa-miR-615-3p	CLASH	23622248
MIRT039677	hsa-miR-615-3p	CLASH	23622248
MIRT038072	hsa-miR-423-5p	CLASH	23622248
MIRT038072	hsa-miR-423-5p	CLASH	23622248
MIRT035865	hsa-miR-1250-5p	CLASH	23622248
MIRT1441677	hsa-miR-1538	CLIP-seq
MIRT1441678	hsa-miR-214	CLIP-seq
MIRT1441679	hsa-miR-296-5p	CLIP-seq
MIRT1441680	hsa-miR-3141	CLIP-seq
MIRT1441681	hsa-miR-3180	CLIP-seq
MIRT1441682	hsa-miR-3180-3p	CLIP-seq
MIRT1441683	hsa-miR-3196	CLIP-seq
MIRT1441684	hsa-miR-3619-5p	CLIP-seq
MIRT1441685	hsa-miR-3689d	CLIP-seq
MIRT1441686	hsa-miR-378g	CLIP-seq
MIRT1441687	hsa-miR-3960	CLIP-seq
MIRT1441688	hsa-miR-4291	CLIP-seq
MIRT1441689	hsa-miR-4437	CLIP-seq
MIRT1441690	hsa-miR-4446-3p	CLIP-seq
MIRT1441691	hsa-miR-4467	CLIP-seq
MIRT1441692	hsa-miR-4492	CLIP-seq
MIRT1441693	hsa-miR-4498	CLIP-seq
MIRT1441694	hsa-miR-4505	CLIP-seq
MIRT1441695	hsa-miR-4532	CLIP-seq
MIRT1441696	hsa-miR-4674	CLIP-seq
MIRT1441697	hsa-miR-4685-5p	CLIP-seq
MIRT1441698	hsa-miR-4745-3p	CLIP-seq
MIRT1441699	hsa-miR-761	CLIP-seq
MIRT1441700	hsa-miR-762	CLIP-seq
MIRT1441701	hsa-miR-1203	CLIP-seq
MIRT1441702	hsa-miR-1285	CLIP-seq
MIRT1441678	hsa-miR-214	CLIP-seq
MIRT1441703	hsa-miR-2277-5p	CLIP-seq
MIRT1441704	hsa-miR-2861	CLIP-seq
MIRT1441705	hsa-miR-3187-5p	CLIP-seq
MIRT1441684	hsa-miR-3619-5p	CLIP-seq
MIRT1441706	hsa-miR-3648	CLIP-seq
MIRT1441685	hsa-miR-3689d	CLIP-seq
MIRT1441707	hsa-miR-4258	CLIP-seq
MIRT1441688	hsa-miR-4291	CLIP-seq
MIRT1441708	hsa-miR-4514	CLIP-seq
MIRT1441709	hsa-miR-4660	CLIP-seq
MIRT1441710	hsa-miR-4692	CLIP-seq
MIRT1441711	hsa-miR-4706	CLIP-seq
MIRT1441712	hsa-miR-4749-5p	CLIP-seq
MIRT1441713	hsa-miR-612	CLIP-seq
MIRT1441714	hsa-miR-646	CLIP-seq
MIRT1441715	hsa-miR-661	CLIP-seq
MIRT1441699	hsa-miR-761	CLIP-seq
MIRT1441716	hsa-miR-939	CLIP-seq

Gene ontology (GO) Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21343306, 22119785, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0036503	Process	ERAD pathway	IBA
GO:0036503	Process	ERAD pathway	IEA
GO:0036503	Process	ERAD pathway	IMP	21343306
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0055037	Component	Recycling endosome	IEA

Other IDs

• MIM: 614792
• HGNC: 21709
• e!Ensembl: ENSG00000164897

Protein

• UniProt ID: Q9BVT8
• Protein name: Transmembrane and ubiquitin-like domain-containing protein 1 (Dendritic cell-derived ubiquitin-like protein) (DULP) (Hepatocyte odd protein shuttling protein) (Ubiquitin-like protein SB144) [Cleaved into: iHOPS]
• Protein function: Involved in sterol-regulated ubiquitination and degradation of HMG-CoA reductase HMGCR (PubMed:21343306). Involved in positive regulation of AMPA-selective glutamate receptor GRIA2 recycling to the cell surface (By similarity). Acts as a negativ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00240	ubiquitin	105 → 174	Ubiquitin family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed with highest levels in mammary and thyroid glands, bone marrow and spleen; limited expression in cardiac, pancreatic and ovarian tissues. {ECO:0000269|PubMed:24240191}.
• Sequence:

  MTLIEGVGDEVTVLFSVLACLLVLALAWVSTHTAEGGDPLPQPSGTPTPSQPSAAMAATD
  SMRGEAPGAETPSLRHRGQAAQPEPSTGFTATPPAPDSPQEPLVLRLKFLNDSEQVARAW
  PHDTIGSLKRTQFPGREQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPNP
  PCPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLA
  FAMYRP

• Sequence length: 246

Related Genes

No strongly related genes found yet for TMUB1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to TMUB1.