TMSB4Y (thymosin beta 4 Y-linked)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 9087
• Gene name: Thymosin beta 4 Y-linked
• Gene symbol: TMSB4Y
• Synonyms (NCBI Gene): TB4Y
• Chromosome: Y
• Chromosome location: Yq11.221
• Summary: This gene lies within the male specific region of chromosome Y. Its homolog on chromosome X escapes X inactivation and encodes an actin sequestering protein. [provided by RefSeq, Jul 2008]

miRNA Show/Hide all (13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1441316	hsa-miR-3065-5p	CLIP-seq
MIRT1441317	hsa-miR-3124-3p	CLIP-seq
MIRT1441318	hsa-miR-4668-3p	CLIP-seq
MIRT2132090	hsa-miR-103a	CLIP-seq
MIRT2132091	hsa-miR-107	CLIP-seq
MIRT2132092	hsa-miR-3908	CLIP-seq
MIRT2132093	hsa-miR-4540	CLIP-seq
MIRT2462020	hsa-miR-214	CLIP-seq
MIRT2462021	hsa-miR-2964a-5p	CLIP-seq
MIRT2462022	hsa-miR-3619-5p	CLIP-seq
MIRT2462023	hsa-miR-4291	CLIP-seq
MIRT2462024	hsa-miR-761	CLIP-seq
MIRT2462025	hsa-miR-922	CLIP-seq

Gene ontology (GO) Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003779	Function	Actin binding	IEA
GO:0003785	Function	Actin monomer binding	IBA
GO:0003785	Function	Actin monomer binding	IEA
GO:0005515	Function	Protein binding	IPI	21044950
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0007015	Process	Actin filament organization	IEA
GO:0008064	Process	Regulation of actin polymerization or depolymerization	TAS
GO:0030334	Process	Regulation of cell migration	IBA
GO:0030334	Process	Regulation of cell migration	IEA
GO:0140311	Function	Protein sequestering activity	IBA

Other IDs

• MIM: 400017
• HGNC: 11882
• e!Ensembl: ENSG00000154620

Protein

• UniProt ID: O14604
• Protein name: Thymosin beta-4, Y-chromosomal
• Protein function: Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01290	Thymosin	3 → 41	Thymosin beta-4 family	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous.
• Sequence:

  MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES

• Sequence length: 44

Pathways

KEGG Pathway:

Regulation of actin cytoskeleton

Related Genes

No strongly related genes found yet for TMSB4Y.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to TMSB4Y.