TMPRSS7 (transmembrane serine protease 7)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 344805
• Gene name: Transmembrane serine protease 7
• Gene symbol: TMPRSS7
• Synonyms (NCBI Gene): -
• Chromosome: 3
• Chromosome location: 3q13.2

miRNA Show/Hide all (20)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1441189	hsa-miR-1193	CLIP-seq
MIRT1441190	hsa-miR-1913	CLIP-seq
MIRT1441191	hsa-miR-192	CLIP-seq
MIRT1441192	hsa-miR-197	CLIP-seq
MIRT1441193	hsa-miR-215	CLIP-seq
MIRT1441194	hsa-miR-2392	CLIP-seq
MIRT1441195	hsa-miR-324-3p	CLIP-seq
MIRT1441196	hsa-miR-4662a-5p	CLIP-seq
MIRT1441197	hsa-miR-4676-5p	CLIP-seq
MIRT1441198	hsa-miR-4707-3p	CLIP-seq
MIRT1441199	hsa-miR-4716-5p	CLIP-seq
MIRT1441200	hsa-miR-5096	CLIP-seq
MIRT1441201	hsa-miR-575	CLIP-seq
MIRT2353194	hsa-miR-1234	CLIP-seq
MIRT2353195	hsa-miR-150	CLIP-seq
MIRT2353196	hsa-miR-3934	CLIP-seq
MIRT2353197	hsa-miR-4275	CLIP-seq
MIRT2353198	hsa-miR-4731-5p	CLIP-seq
MIRT2353199	hsa-miR-5095	CLIP-seq
MIRT2353200	hsa-miR-552	CLIP-seq

Gene ontology (GO) Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	ISS
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IBA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	ISS
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q7RTY8
• Protein name: Transmembrane protease serine 7 (EC 3.4.21.-) (Matriptase-3)
• Protein function: Serine protease which preferentially hydrolyzes peptides with Arg at the P1 position.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00057	Ldl_recept_a	482 → 518	Low-density lipoprotein receptor domain class A	Repeat
  PF00057	Ldl_recept_a	557 → 594	Low-density lipoprotein receptor domain class A	Repeat
  PF00089	Trypsin	606 → 835	Trypsin	Domain
  PF00431	CUB	365 → 470	CUB domain	Domain
  PF00431	CUB	247 → 357	CUB domain	Domain
  PF01390	SEA	108 → 214	SEA domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain, ovary, testis, salivary gland, trachea and lung. {ECO:0000269|PubMed:15853774}.
• Sequence:

  MDKENSDVSAAPADLKISNISVQVVSAQKKLPVRRPPLPGRRLPLPGRRPPQRPIGKAKP
  KKQSKKKVPFWNVQNKIILFTVFLFILAVIAWTLLWLYISKTESKDAFYFAGMFRITNIE
  FLPEYRQKESREFLSVSRTVQQVINLVYTTSAFSKFYEQSVVADVSSNNKGGLLVHFWIV
  FVMPRAKGHIFCEDCVAAILKDSIQTSIINRTSVGSLQGLAVDMDSVVLNAGLRSDYSST
  IGSDKGCSQYFYAEHLSLHYPLEISAASGRLMCHFKLVAIVGYLIRLSIKSIQIEADNCV
  TDSLTIYDSLLPIRSSILYRICEPTRTLMSFVSTNNLMLVTFKSPHIRRLSGIRAYFEVI
  PEQKCENTVLVKDITGFEGKISSPYYPSYYPPKCKCTWKFQTSLSTLGIALKFYNYSITK
  KSMKGCEHGWWEINEHMYCGSYMDHQTIFRVPSPLVHIQLQCSSRLSDKPLLAEYGSYNI
  SQPCPVGSFRCSSGLCVPQAQRCDGVNDCFDESDELFCVSPQPACNTSSFRQHGPLICDG
  FRDCENGRDEQNCTQSIPCNNRTFKCGNDICFRKQNAKCDGTVDCPDGSDEEGCTCSRSS
  SALHRIIGGTDTLEGGWPWQVSLHFVGSAYCGASVISREWLLSAAHCFHGNRLSDPTPWT
  AHLGMYVQGNAKFVSPVRRIVVHEYYNSQTFDYDIALLQLSIAWPETLKQLIQPICIPPT
  GQRVRSGEKCWVTGWGRRHEADNKGSLVLQQAEVELIDQTLCVSTYGIITSRMLCAGIMS
  GKRDACKGDSGGPLSCRRKSDGKWILTGIVSWGHGSGRPNFPGVYTRVSNFVPWIHKYVP
  SLL

• Sequence length: 843

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ASTHMA	—	GWAS catalog	35472084	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	35472084	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	25029565		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25029565	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	28487959	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25029565		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for TMPRSS7.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to TMPRSS7.