TMIGD1 (transmembrane and immunoglobulin domain containing 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 388364
• Gene name: Transmembrane and immunoglobulin domain containing 1
• Gene symbol: TMIGD1
• Synonyms (NCBI Gene): TMIGD, UNQ9372
• Chromosome: 17
• Chromosome location: 17q11.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2693579	hsa-miR-216a	CLIP-seq
MIRT2693580	hsa-miR-4275	CLIP-seq
MIRT2693581	hsa-miR-4762-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	37542259
GO:0005737	Component	Cytoplasm	IDA	26342724
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA	26342724
GO:0005886	Component	Plasma membrane	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0008104	Process	Intracellular protein localization	IEA
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IEA
GO:0030334	Process	Regulation of cell migration	IDA	26342724
GO:0042127	Process	Regulation of cell population proliferation	IDA	26342724
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	26342724
GO:0045216	Process	Cell-cell junction organization	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0060574	Process	Intestinal epithelial cell maturation	IEA
GO:0071447	Process	Cellular response to hydroperoxide	IEA
GO:0090559	Process	Regulation of membrane permeability	IMP	26342724
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098631	Function	Cell adhesion mediator activity	IEA
GO:0098632	Function	Cell-cell adhesion mediator activity	IEA
GO:0098743	Process	Cell aggregation	IEA
GO:1904970	Process	Brush border assembly	IEA

Other IDs

• MIM: 621206
• HGNC: 32431
• e!Ensembl: ENSG00000182271

Protein

• UniProt ID: Q6UXZ0
• Protein name: Transmembrane and immunoglobulin domain-containing protein 1
• Protein function: May control cell-cell adhesion, cell migration and proliferation, cell morphology, and protects renal epithelial cells from oxidative cell injury to promote cell survival.
• PDB: 8CD3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07679	I-set	126 → 212	Immunoglobulin I-set domain	Domain

• Sequence:

  MAWKSSVIMQMGRFLLLVILFLPREMTSSVLTVNGKTENYILDTTPGSQASLICAVQNHT
  REEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVT
  FPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQL
  SITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVPIEPIIAACVVIFLTLCFGLI
  ARRKKIMKLCMKDKDPHSETAL

• Sequence length: 262

Related Genes

No strongly related genes found yet for TMIGD1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to TMIGD1.