TMEM88 (transmembrane protein 88)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 92162
Gene name Transmembrane protein 88
Gene symbol TMEM88
Synonyms (NCBI Gene)
-
Chromosome 17
Chromosome location 17p13.1
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT006941 hsa-miR-708-5p Luciferase reporter assayqRT-PCR 22573352
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14 Show/Hide all (14)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 26359454, 32296183
GO:0005829 Component Cytosol IDA 26359454
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IDA 21044957, 26359454
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
617813 32371 ENSG00000167874
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6PEY1
Protein name Transmembrane protein 88
Protein function Inhibits the Wnt/beta-catenin signaling pathway. Crucial for heart development and acts downstream of GATA factors in the pre-cardiac mesoderm to specify lineage commitment of cardiomyocyte development.
Family and domains
Sequence 
MADVPGAQRAVPGDGPEPRDPLDCWACAVLVTAQNLLVAAFNLLLLVLVLGTILLPAVTM
LGFGFLCHSQFLRSQAPPCTAHLRDPGFTALLVTGFLLLVPLLVLALASYRRLCLRLRLA
DCLVPYSRALYRRRRAPQPRQIRASPGSQAVPTSGKVWV
Sequence length 159
Interactions View interactions

No strongly related genes found yet for TMEM88.

No additional diseases found yet through genes similar to TMEM88.