TMEM30CP (transmembrane protein 30C, pseudogene)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 644444 |
| Gene name | Transmembrane protein 30C, pseudogene |
| Gene symbol | TMEM30CP |
| Synonyms (NCBI Gene) |
CDC50CTMEM30C
|
| Chromosome | 3 |
| Chromosome location | 3q12.1 |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
|
|||||||||||
|
|||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
A0ZSE6 |
| Protein name | Cell cycle control protein 50C (Transmembrane protein 30C) |
| Family and domains | |
| Tissue specificity | TISSUE SPECIFICITY: Specifically expressed in testis. {ECO:0000269|PubMed:17258408}. |
| Sequence |
MEERAQHCLSRLLDNSALKQQELPIHRLYFTARRVLFVFFATGIFCLCMGIILILSARST |
| Sequence length | 113 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with TMEM30CP across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to TMEM30CP (see Related Genes above), that are NOT already directly curated for TMEM30CP itself -- a lead worth checking, not a confirmed association.
0
|
|