TMEM223 (transmembrane protein 223)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 79064
• Gene name: Transmembrane protein 223
• Gene symbol: TMEM223
• Synonyms (NCBI Gene): Mrx15
• Chromosome: 11
• Chromosome location: 11q12.3

miRNA Show/Hide all (51)

miRTarBase ID	miRNA	Experiments	Reference
MIRT037772	hsa-miR-671-3p	CLASH	23622248
MIRT1435626	hsa-miR-136	CLIP-seq
MIRT1435627	hsa-miR-147	CLIP-seq
MIRT1435628	hsa-miR-3145-5p	CLIP-seq
MIRT1435629	hsa-miR-323b-5p	CLIP-seq
MIRT1435630	hsa-miR-4263	CLIP-seq
MIRT1435631	hsa-miR-4725-5p	CLIP-seq
MIRT1435632	hsa-miR-504	CLIP-seq
MIRT1435633	hsa-miR-508-5p	CLIP-seq
MIRT1435634	hsa-miR-581	CLIP-seq
MIRT2351874	hsa-miR-378g	CLIP-seq
MIRT2351875	hsa-miR-4423-5p	CLIP-seq
MIRT2351876	hsa-miR-4437	CLIP-seq
MIRT2351877	hsa-miR-4519	CLIP-seq
MIRT2351878	hsa-miR-4674	CLIP-seq
MIRT2351879	hsa-miR-661	CLIP-seq
MIRT2645680	hsa-miR-1258	CLIP-seq
MIRT2645681	hsa-miR-192	CLIP-seq
MIRT2645682	hsa-miR-2053	CLIP-seq
MIRT2645683	hsa-miR-215	CLIP-seq
MIRT2645684	hsa-miR-22	CLIP-seq
MIRT2645685	hsa-miR-2682	CLIP-seq
MIRT2645686	hsa-miR-3157-3p	CLIP-seq
MIRT2645687	hsa-miR-4268	CLIP-seq
MIRT2645688	hsa-miR-4423-3p	CLIP-seq
MIRT2645689	hsa-miR-4448	CLIP-seq
MIRT2645690	hsa-miR-449c	CLIP-seq
MIRT2645691	hsa-miR-452	CLIP-seq
MIRT2645692	hsa-miR-4676-3p	CLIP-seq
MIRT2645693	hsa-miR-4738-3p	CLIP-seq
MIRT2645694	hsa-miR-569	CLIP-seq
MIRT2645695	hsa-miR-877	CLIP-seq
MIRT2645696	hsa-miR-940	CLIP-seq
MIRT2645680	hsa-miR-1258	CLIP-seq
MIRT1435626	hsa-miR-136	CLIP-seq
MIRT2645684	hsa-miR-22	CLIP-seq
MIRT2645685	hsa-miR-2682	CLIP-seq
MIRT1435628	hsa-miR-3145-5p	CLIP-seq
MIRT2645686	hsa-miR-3157-3p	CLIP-seq
MIRT1435629	hsa-miR-323b-5p	CLIP-seq
MIRT1435630	hsa-miR-4263	CLIP-seq
MIRT2645688	hsa-miR-4423-3p	CLIP-seq
MIRT2645690	hsa-miR-449c	CLIP-seq
MIRT2645691	hsa-miR-452	CLIP-seq
MIRT2645692	hsa-miR-4676-3p	CLIP-seq
MIRT1435631	hsa-miR-4725-5p	CLIP-seq
MIRT2645693	hsa-miR-4738-3p	CLIP-seq
MIRT1435632	hsa-miR-504	CLIP-seq
MIRT1435633	hsa-miR-508-5p	CLIP-seq
MIRT2645695	hsa-miR-877	CLIP-seq
MIRT2645696	hsa-miR-940	CLIP-seq

Gene ontology (GO) Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	32275929
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	34969438
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0033617	Process	Mitochondrial cytochrome c oxidase assembly	IDA	34969438
GO:0097177	Function	Mitochondrial ribosome binding	IDA	34969438

Other IDs

• MIM: 620434
• HGNC: 28464
• e!Ensembl: ENSG00000168569

Protein

• UniProt ID: A0PJW6
• Protein name: Transmembrane protein 223
• Protein function: Mitochondrial ribosome-associated protein involved in the first steps of cytochrome c oxidase complex (complex IV) biogenesis (PubMed:34969438). Stimulates the translation of MT-CO1 mRNA and is a constituent of early MT-CO1 assembly intermediate
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14640	TMEM223	32 → 200		Family

• Sequence:

  MAAPWRRWPTGLLAVLRPLLTCRPLQGTTLQRDVLLFEHDRGRFFTILGLFCAGQGVFWA
  SMAVAAVSRPPVPVQPLDAEVPNRGPFDLRSALWRYGLAVGCGAIGALVLGAGLLFSLRS
  VRSVVLRAGGQQVTLTTHAPFGLGAHFTVPLKQVSCMAHRGEVPAMLPLKVKGRRFYFLL
  DKTGHFPNTKLFDNTVGAYRSL

• Sequence length: 202

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Melanoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	32783527	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for TMEM223.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to TMEM223.