TMEM208 (transmembrane protein 208)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 29100
• Gene name: Transmembrane protein 208
• Gene symbol: TMEM208
• Synonyms (NCBI Gene): HSPC171, SND2, hSND2
• Chromosome: 16
• Chromosome location: 16q22.1
• Summary: This gene encodes a highly conserved protein which is localized in the endoplasmic reticulum (ER). The protein is linked to autophagy and ER stress. Knockdown of this gene increased autophagy and triggered ER stress. Alternative splicing results in multip

miRNA Show/Hide all (19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029156	hsa-miR-26b-5p	Microarray	19088304
MIRT2645473	hsa-miR-1915	CLIP-seq
MIRT2645474	hsa-miR-3677-5p	CLIP-seq
MIRT2645475	hsa-miR-3918	CLIP-seq
MIRT2645476	hsa-miR-4640-5p	CLIP-seq
MIRT2645477	hsa-miR-4685-5p	CLIP-seq
MIRT2645478	hsa-miR-4701-5p	CLIP-seq
MIRT2645479	hsa-miR-4726-5p	CLIP-seq
MIRT2645480	hsa-miR-588	CLIP-seq
MIRT2645481	hsa-miR-663b	CLIP-seq
MIRT2645473	hsa-miR-1915	CLIP-seq
MIRT2645474	hsa-miR-3677-5p	CLIP-seq
MIRT2645475	hsa-miR-3918	CLIP-seq
MIRT2645476	hsa-miR-4640-5p	CLIP-seq
MIRT2645477	hsa-miR-4685-5p	CLIP-seq
MIRT2645478	hsa-miR-4701-5p	CLIP-seq
MIRT2645479	hsa-miR-4726-5p	CLIP-seq
MIRT2645480	hsa-miR-588	CLIP-seq
MIRT2645481	hsa-miR-663b	CLIP-seq

Gene ontology (GO) Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005773	Component	Vacuole	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	38381787
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006624	Process	Vacuolar protein processing	IBA
GO:0006914	Process	Autophagy	IEA
GO:0016020	Component	Membrane	IEA
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA

Other IDs

• MIM: 620781
• HGNC: 25015
• e!Ensembl: ENSG00000168701

Protein

• UniProt ID: Q9BTX3
• Protein name: Transmembrane protein 208
• Protein function: May function as a negative regulator of endoplasmic reticulum-stress induced autophagy.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05620	TMEM208_SND2	7 → 170	SRP-independent targeting protein 2/TMEM208	Family

• Sequence:

  MAPKGKVGTRGKKQIFEENRETLKFYLRIILGANAIYCLVTLVFFYSSASFWAWLALGFS
  LAVYGASYHSMSSMARAAFSEDGALMDGGMDLNMEQGMAEHLKDVILLTAIVQVLSCFSL
  YVWSFWLLAPGRALYLLWVNVLGPWFTADSGTPAPEHNEKRQRRQERRQMKRL

• Sequence length: 173

Pathways

KEGG Pathway:

Protein export

Related Genes

No strongly related genes found yet for TMEM208.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to TMEM208.