TMEM205 (transmembrane protein 205)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 374882
Gene name Transmembrane protein 205
Gene symbol TMEM205
Synonyms (NCBI Gene)
UNQ501
Chromosome 19
Chromosome location 19p13.2
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT036654 hsa-miR-935 CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 32814053, 33961781
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
613771 29631 ENSG00000105518
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6UW68
Protein name Transmembrane protein 205
Protein function In cancer cells, plays a role in resistance to the chemotherapeutic agent cisplatin.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13664 DUF4149 17 → 118 Domain of unknown function (DUF4149) Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed with highest levels in pancreas, followed by adrenal gland, thyroid, liver, mammary gland, prostate, kidney, and retina; lowest levels in skeletal muscle. Overexpressed in cisplatin-resistant cancer cells (at protein l
Sequence 
MEEGGNLGGLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHI
SMGCAFINLCILASQHAWAQLTFWEASQLYLLFLSLTLATVNARWLEPRTTAAMWALQTV
EKERGLGGEVPGSHQGPDPYRQLREKDPKYSALRQNFFRYHGLSSLCNLGCVLSNGLCLA
GLALEIRSL
Sequence length 189
Interactions View interactions

No strongly related genes found yet for TMEM205.

No additional diseases found yet through genes similar to TMEM205.