Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	79652
Gene name	Transmembrane protein 204
Gene symbol	TMEM204
Synonyms (NCBI Gene)	C16orf30CLP24
Chromosome	16
Chromosome location	16p13.3
Summary	C16ORF30 plays a role in cell adhesion and cellular permeability at adherens junctions (Kearsey et al., 2004 [PubMed 15206924]).[supplied by OMIM, Mar 2008]

12 Show/Hide all (12)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016365	hsa-miR-193b-3p	Microarray	20304954
MIRT1435094	hsa-miR-1909	CLIP-seq
MIRT1435095	hsa-miR-3164	CLIP-seq
MIRT1435096	hsa-miR-3165	CLIP-seq
MIRT1435097	hsa-miR-323-5p	CLIP-seq
MIRT1435098	hsa-miR-4271	CLIP-seq
MIRT1435099	hsa-miR-4725-3p	CLIP-seq
MIRT1435100	hsa-miR-876-3p	CLIP-seq
MIRT1435094	hsa-miR-1909	CLIP-seq
MIRT1435095	hsa-miR-3164	CLIP-seq
MIRT1435098	hsa-miR-4271	CLIP-seq
MIRT1435099	hsa-miR-4725-3p	CLIP-seq

11 Show/Hide all (11)

GO ID	Ontology	Definition	Evidence
GO:0001945	Process	Lymph vessel development	IBA
GO:0001945	Process	Lymph vessel development	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005912	Component	Adherens junction	IEA
GO:0016020	Component	Membrane	IEA
GO:0030947	Process	Regulation of vascular endothelial growth factor receptor signaling pathway	IBA
GO:0030947	Process	Regulation of vascular endothelial growth factor receptor signaling pathway	IEA
GO:0051145	Process	Smooth muscle cell differentiation	IBA
GO:0051145	Process	Smooth muscle cell differentiation	IEA
GO:0070161	Component	Anchoring junction	IEA

MIM	HGNC	e!Ensembl
611002	14158	ENSG00000131634

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q9BSN7
Protein name	Transmembrane protein 204 (Claudin-like protein 24)
Protein function	Can influence paracellular permeability. Appears to be involved in cell-cell interactions through adherens.
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Highly expressed in lung, heart, kidney and placenta. Lower expression in thymus, spleen, liver, testis and ovary. Expressed in endothelial and restricted epithelial cell populations. {ECO:0000269\|PubMed:15206924}.
Sequence	MTVQRLVAAAVLVALVSLILNNVAAFTSNWVCQTLEDGRRRSVGLWRSCWLVDRTRGGPS PGARAGQVDAHDCEALGWGSEAAGFQESRGTVKLQFDMMRACNLVATAALTAGQLTFLLG LVGLPLLSPDAPCWEEAMAAAFQLASFVLVIGLVTFYRIGPYTNLSWSCYLNIGACLLAT LAAAMLIWNILHKREDCMAPRVIVISRSLTARFRRGLDNDYVESPC
Sequence length	226
Interactions	View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CORONARY ARTERY DISEASE	—	GWAS catalog	29212778, 33020668	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAINZER-SALDINO DISEASE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	34290314, 38538606	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	34290314, 38538606	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER CANCER	—	GWAS catalog	34353775	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21723258	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21723258	★★★★★ ★☆☆☆☆ Found in Text Mining only

TMEM204 (transmembrane protein 204)

Bookmark This Gene