TMEM190 (transmembrane protein 190)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 147744
Gene name Transmembrane protein 190
Gene symbol TMEM190
Synonyms (NCBI Gene)
MDAC1
Chromosome 19
Chromosome location 19q13.42
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT017729 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002079 Component Inner acrosomal membrane IBA
GO:0002079 Component Inner acrosomal membrane IEA
GO:0002244 Process Hematopoietic progenitor cell differentiation IBA
GO:0002244 Process Hematopoietic progenitor cell differentiation IEA
GO:0005515 Function Protein binding IPI 25416956, 31515488, 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WZ59
Protein name Transmembrane protein 190
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15431 TMEM190 21 → 146 Transmembrane protein 190 Family
Sequence 
MLGCGIPALGLLLLLQGSADGNGIQGFFYPWSCEGDIWDRESCGGQAAIDSPNLCLRLRC
CYRNGVCYHQRPDENVRRKHMWALVWTCSGLLLLSCSICLFWWAKRRDVLHMPGFLAGPC
DMSKSVSLLSKHRGTKKTPSTGSVPVALSKESRDVEGGTEGEGTEEGEETEGEEEED
Sequence length 177
Interactions View interactions

No strongly related genes found yet for TMEM190.

No additional diseases found yet through genes similar to TMEM190.