TMEM183BP (transmembrane protein 183B, pseudogene)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 653659
Gene name Transmembrane protein 183B, pseudogene
Gene symbol TMEM183BP
Synonyms (NCBI Gene)
C1ORF37DUPC1orf37-DUPTMEM183B
Chromosome 3
Chromosome location 3q25.1
Summary This locus was thought to represent a pseudogene of chromosome 1 open reading frame 37 because it is intronless and retains a polyA tail at the 3` end. It does however contain a complete open reading frame that subsequent research has demonstrated to be t
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0016020 Component Membrane IEA
GO:0019005 Component SCF ubiquitin ligase complex IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
611365 33205 ENSG00000224831
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q1AE95
Protein name Putative transmembrane protein 183BP (Transmembrane protein 183B pseudogene)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in brain, lung, pancreas, thymus, intestine and blood. Not detected in heart, placenta, liver, muscle, kidney, spleen, prostate, testis, ovary and colon. {ECO:0000269|PubMed:16644869}.
Sequence 
MARGPGPLGRPRPDTVAMPKRGKRLKFRAHDACSGRVTVADYADSDLAVVRSGRVKKAVA
NAVRQEVKSLCGLEASQVPAEEALSGAGEPYDIIDSSDEMDAQEENIHERTVSRKKKSKR
HKEELDGAGGEEYPMDIWLLLASYIRPEDIVNFSLICKNAWTVTCTAAFWTRLYRRHYTL
DASLPLRLRPESMEKLHCLRACVIRSLYHMYEPFAARISKNPAIPESTPSTLKNSKCLLF
WCRKIVGNRQEPMWEFNFKFKKQSPRLKSKCTGGLQPPVQYEDVHTNPDQDCCLLQVTTL
NFIFIPIVMGMIFTLFTINVSTDMRHHRVRLVFQDSPVHGGRKLRSEQGVQVILDPVHSV
RLFDWWHPQYPFSLRA
Sequence length 376
Interactions View interactions

No strongly related genes found yet for TMEM183BP.

No additional diseases found yet through genes similar to TMEM183BP.