TMEM158 (transmembrane protein 158) | GeDiPNet

GeDiPNet

Log in to bookmark this gene

Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	25907
Gene name	Transmembrane protein 158
Gene symbol	TMEM158
Synonyms (NCBI Gene)	BBPRIS1p40BBP
Chromosome	3
Chromosome location	3p21.31
Summary	Constitutive activation of the Ras pathway triggers an irreversible proliferation arrest reminiscent of replicative senescence. Transcription of this gene is upregulated in response to activation of the Ras pathway, but not under other conditions that ind

42 Show/Hide all (42)

miRTarBase ID	miRNA	Experiments	Reference
MIRT442729	hsa-miR-496	PAR-CLIP	22100165
MIRT442727	hsa-miR-548ac	PAR-CLIP	22100165
MIRT442726	hsa-miR-548bb-3p	PAR-CLIP	22100165
MIRT442725	hsa-miR-548d-3p	PAR-CLIP	22100165
MIRT442724	hsa-miR-548h-3p	PAR-CLIP	22100165
MIRT442723	hsa-miR-548z	PAR-CLIP	22100165
MIRT442722	hsa-miR-548e-5p	PAR-CLIP	22100165
MIRT442721	hsa-miR-654-3p	PAR-CLIP	22100165
MIRT442720	hsa-miR-3613-3p	PAR-CLIP	22100165
MIRT442719	hsa-miR-4742-3p	PAR-CLIP	22100165
MIRT442729	hsa-miR-496	PAR-CLIP	22100165
MIRT442727	hsa-miR-548ac	PAR-CLIP	22100165
MIRT442726	hsa-miR-548bb-3p	PAR-CLIP	22100165
MIRT442725	hsa-miR-548d-3p	PAR-CLIP	22100165
MIRT442724	hsa-miR-548h-3p	PAR-CLIP	22100165
MIRT442723	hsa-miR-548z	PAR-CLIP	22100165
MIRT442722	hsa-miR-548e-5p	PAR-CLIP	22100165
MIRT442721	hsa-miR-654-3p	PAR-CLIP	22100165
MIRT442720	hsa-miR-3613-3p	PAR-CLIP	22100165
MIRT442719	hsa-miR-4742-3p	PAR-CLIP	22100165
MIRT1431687	hsa-miR-1243	CLIP-seq
MIRT1431688	hsa-miR-1972	CLIP-seq
MIRT1431689	hsa-miR-3120-3p	CLIP-seq
MIRT1431690	hsa-miR-3942-5p	CLIP-seq
MIRT1431691	hsa-miR-4703-5p	CLIP-seq
MIRT1431692	hsa-miR-4717-5p	CLIP-seq
MIRT1431693	hsa-miR-4733-3p	CLIP-seq
MIRT1431694	hsa-miR-4753-3p	CLIP-seq
MIRT1431695	hsa-miR-550b	CLIP-seq
MIRT1431696	hsa-miR-942	CLIP-seq
MIRT2129388	hsa-miR-1910	CLIP-seq
MIRT2129389	hsa-miR-3158-3p	CLIP-seq
MIRT2129390	hsa-miR-4264	CLIP-seq
MIRT2129391	hsa-miR-455-3p	CLIP-seq
MIRT2129392	hsa-miR-4686	CLIP-seq
MIRT2129388	hsa-miR-1910	CLIP-seq
MIRT1431689	hsa-miR-3120-3p	CLIP-seq
MIRT2129389	hsa-miR-3158-3p	CLIP-seq
MIRT2129390	hsa-miR-4264	CLIP-seq
MIRT2395964	hsa-miR-4466	CLIP-seq
MIRT2129391	hsa-miR-455-3p	CLIP-seq
MIRT2395965	hsa-miR-675	CLIP-seq

1

Transcription factor	Regulation	Reference
ETS1	Activation	11822868

2

GO ID	Ontology	Definition	Evidence	Reference
GO:0016020	Component	Membrane	IEA
GO:0042277	Function	Peptide binding	IBA

MIM	HGNC	e!Ensembl
620257	30293	ENSG00000249992

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q8WZ71
Protein name	Transmembrane protein 158 (40 kDa BINP-binding protein) (p40BBP) (Ras-induced senescence protein 1)
Protein function	Receptor for brain injury-derived neurotrophic peptide (BINP), a synthetic 13-mer peptide.
Family and domains
Sequence	MLPLLAALLAAACPLPPVRGGAADAPGLLGVPSNASVNASSADEPIAPRLLASAAPGPPE RPGPEEAAAAAAPCNISVQRQMLSSLLVRWGRPRGFQCDLLLFSTNAHGRAFFAAAFHRV GPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGRLRPAAAPSAAAATAGAPTALPAYP AAEPPGPLWLQGEPLHFCCLDFSLEELQGEPGWRLNRKPIESTLVACFMTLVIVVWSVAA LIWPVPIIAGFLPNGMEQRRTTASTTAATPAAVPAGTTAAAAAAAAAAAAAAVTSGVATK
Sequence length	300
Interactions	View interactions