Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	135932
Gene name	Transmembrane protein 139
Gene symbol	TMEM139
Synonyms (NCBI Gene)	-
Chromosome	7
Chromosome location	7q34

25 Show/Hide all (25)

miRTarBase ID	miRNA	Experiments
MIRT1431128	hsa-miR-198	CLIP-seq
MIRT1431129	hsa-miR-2964a-5p	CLIP-seq
MIRT1431130	hsa-miR-4514	CLIP-seq
MIRT1431131	hsa-miR-4645-5p	CLIP-seq
MIRT1431132	hsa-miR-4673	CLIP-seq
MIRT1431133	hsa-miR-4692	CLIP-seq
MIRT1431134	hsa-miR-1303	CLIP-seq
MIRT1431135	hsa-miR-4274	CLIP-seq
MIRT1431136	hsa-miR-4290	CLIP-seq
MIRT1431137	hsa-miR-4302	CLIP-seq
MIRT1431138	hsa-miR-4519	CLIP-seq
MIRT1431139	hsa-miR-4655-3p	CLIP-seq
MIRT1431140	hsa-miR-4661-5p	CLIP-seq
MIRT1431141	hsa-miR-517a	CLIP-seq
MIRT1431142	hsa-miR-517b	CLIP-seq
MIRT1431143	hsa-miR-517c	CLIP-seq
MIRT1431144	hsa-miR-648	CLIP-seq
MIRT2350823	hsa-miR-326	CLIP-seq
MIRT2350824	hsa-miR-330-5p	CLIP-seq
MIRT2350825	hsa-miR-4782-5p	CLIP-seq
MIRT2350826	hsa-miR-942	CLIP-seq
MIRT2395930	hsa-miR-1202	CLIP-seq
MIRT2395931	hsa-miR-3972	CLIP-seq
MIRT2395932	hsa-miR-409-3p	CLIP-seq
MIRT2395933	hsa-miR-4423-5p	CLIP-seq

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	26049106, 32296183, 35044719
GO:0016020	Component	Membrane	IEA

MIM	HGNC	e!Ensembl
616524	22058	ENSG00000178826

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q8IV31
Protein name	Transmembrane protein 139
Protein function	May be involved in cellular trafficking of proteins such as SLC4A1.
Family and domains
Sequence	MVPMHLLGRLEKPLLLLCCASFLLGLALLGIKTDITPVAYFFLTLGGFFLFAYLLVRFLE WGLRSQLQSMQTESPGPSGNARDNEAFEVPVYEEAVVGLESQCRPQELDQPPPYSTVVIP PAPEEEQPSHPEGSRRAKLEQRRMASEGSMAQEGSPGRAPINLRLRGPRAVSTAPDLQSL AAVPTLEPLTPPPAYDVCFGHPDDDSVFYEDNWAPP
Sequence length	216
Interactions	View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Familial cancer of breast	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papillary renal cell carcinoma type 1	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	31792675		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with TMEM139 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for TMEM139.

Diseases Linked via Similar Genes Diseases curated for genes most similar to TMEM139 (see Related Genes above), that are NOT already directly curated for TMEM139 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to TMEM139.

TMEM139 (transmembrane protein 139)

Bookmark This Gene