TMEM132E-DT (TMEM132E divergent transcript)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 400591 |
| Gene name | TMEM132E divergent transcript |
| Gene symbol | TMEM132E-DT |
| Synonyms (NCBI Gene) |
C17orf102
|
| Chromosome | 17 |
| Chromosome location | 17q12 |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
|
|||||||||||
|
|||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
A2RUQ5 |
| Protein name | Uncharacterized protein TMEM132E-DT (TMEM132E divergent transcript) |
| Family and domains | |
| Sequence |
MFDFSFPTPASAGTRMGPASCGGRSLHLPQLRFSRVDATAVTDVPFQRMHAPHRAPEVFC |
| Sequence length | 167 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with TMEM132E-DT across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to TMEM132E-DT (see Related Genes above), that are NOT already directly curated for TMEM132E-DT itself -- a lead worth checking, not a confirmed association.
0
|
|