Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	89894
Gene name	Transmembrane protein 116
Gene symbol	TMEM116
Synonyms (NCBI Gene)	-
Chromosome	12
Chromosome location	12q24.13

21 Show/Hide all (21)

miRTarBase ID	miRNA	Experiments	Reference
MIRT439445	hsa-miR-127-5p	HITS-CLIP	24374217
MIRT439445	hsa-miR-127-5p	HITS-CLIP	24374217
MIRT1430036	hsa-miR-1184	CLIP-seq
MIRT1430037	hsa-miR-1205	CLIP-seq
MIRT1430038	hsa-miR-1296	CLIP-seq
MIRT1430039	hsa-miR-2909	CLIP-seq
MIRT1430040	hsa-miR-3158-5p	CLIP-seq
MIRT1430041	hsa-miR-3945	CLIP-seq
MIRT1430042	hsa-miR-4436b-3p	CLIP-seq
MIRT1430043	hsa-miR-4761-3p	CLIP-seq
MIRT1430044	hsa-miR-544	CLIP-seq
MIRT1430036	hsa-miR-1184	CLIP-seq
MIRT1430037	hsa-miR-1205	CLIP-seq
MIRT1430038	hsa-miR-1296	CLIP-seq
MIRT1430039	hsa-miR-2909	CLIP-seq
MIRT1430040	hsa-miR-3158-5p	CLIP-seq
MIRT1430041	hsa-miR-3945	CLIP-seq
MIRT1430042	hsa-miR-4436b-3p	CLIP-seq
MIRT1430043	hsa-miR-4761-3p	CLIP-seq
MIRT2350453	hsa-miR-543	CLIP-seq
MIRT1430044	hsa-miR-544	CLIP-seq

6 Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003674	Function	Molecular_function	ND
GO:0005575	Component	Cellular_component	ND
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	37293153
GO:0007165	Process	Signal transduction	IEA
GO:0008150	Process	Biological_process	ND
GO:0016020	Component	Membrane	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q8NCL8
Protein name	Transmembrane protein 116
Family and domains
Sequence	MKHTQSGQSTSPLVIDYTCRVCQMAFVFSSLIPLLLMTPVFCLGNTSECFQNFSQSHKCI LMHSPPSAMAELPPSANTSVCSTLYFYGIAIFLGSFVLSLLTIMVLLIRAQTLYKKFVKS TGFLGSEQWAVIHIVDQRVRFYPVAFFCCWGPAVILMIIKLTKPQDTKLHMALYVLQALT ATSQGLLNCGVYGWTQHKFHQLKQEARRDADTQTPLLCSQKRFYSRGLNSLESTLTFPAS TSTIF
Sequence length	245
Interactions	View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	39998322	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	38072966	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	34783190	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	33667223	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26169495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with TMEM116 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for TMEM116.

Diseases Linked via Similar Genes Diseases curated for genes most similar to TMEM116 (see Related Genes above), that are NOT already directly curated for TMEM116 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to TMEM116.

TMEM116 (transmembrane protein 116)

Bookmark This Gene