TMEM102 (transmembrane protein 102)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 284114
• Gene name: Transmembrane protein 102
• Gene symbol: TMEM102
• Synonyms (NCBI Gene): CBAP, D2B
• Chromosome: 17
• Chromosome location: 17p13.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023089	hsa-miR-124-3p	Microarray	18668037
MIRT1429461	hsa-miR-1910	CLIP-seq
MIRT1429462	hsa-miR-1915	CLIP-seq
MIRT1429463	hsa-miR-455-3p	CLIP-seq
MIRT1429464	hsa-miR-4685-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	17828305, 32296183
GO:0005739	Component	Mitochondrion	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	IDA	17828305
GO:0009986	Component	Cell surface	IDA	17828305
GO:0010820	Process	Positive regulation of T cell chemotaxis	IEA
GO:0016020	Component	Membrane	IEA
GO:0032991	Component	Protein-containing complex	IDA	23620790
GO:0034097	Process	Response to cytokine	IDA	17828305
GO:0045785	Process	Positive regulation of cell adhesion	IDA	23620790
GO:0045785	Process	Positive regulation of cell adhesion	IEA
GO:0045785	Process	Positive regulation of cell adhesion	IEA
GO:1901028	Process	Regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	IDA	17828305
GO:2000406	Process	Positive regulation of T cell migration	IDA	23620790
GO:2000406	Process	Positive regulation of T cell migration	IEA
GO:2000406	Process	Positive regulation of T cell migration	IEA

Other IDs

• MIM: 613936
• HGNC: 26722
• e!Ensembl: ENSG00000181284

Protein

• UniProt ID: Q8N9M5
• Protein name: Transmembrane protein 102 (Common beta-chain associated protein) (CBAP)
• Protein function: Selectively involved in CSF2 deprivation-induced apoptosis via a mitochondria-dependent pathway.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03281	Mab-21	260 → 462	Mab-21 protein	Family

• Sequence:

  MASAVWGSAPWWGPPPPAPARPLTDIDFCSGAQLQELTQLIQELGVQESWSDGPKPGADL
  LRAKDFVFSLLGLVHRRDPRFPPQAELLLLRGGIREGSLDLGHAPLGPYARGPHYDAGFT
  LLVPMFSLDGTELQLDLESCYAQVCLPEMVCGTPIREMWQDCLGPPVPGARDSIHRTESE
  ESSKDWQSSVDQPHSYVTEHEAPVSLEKSPSDVSASESPQHDVVDLGSTAPLKTMSSDVT
  KAAVESPVPKPSEAREAWPTLCSAQVAAWFFATLAAVAESLIPVPGAPRLVHAARHAGFT
  TVLLATPEPPRRLLLFDLIPVVSVAGWPEGARSHSWAGPLASESASFYLVPGGGTERPCA
  SAWQLCFARQELALKARIPAPLLQAHAAAQALLRPLVAGTRAAAPYLLRTLLYWACERLP
  ALYLARPENAGACCLGLLDELGRVLEAGTLPHYFLNGRQLRTGDDSAALLGELARLRGDP
  ARALRAAVEEAKVARKGGGLAGVGGGAH

• Sequence length: 508

Related Genes

No strongly related genes found yet for TMEM102.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to TMEM102.