TMED6 (transmembrane p24 trafficking protein 6)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 146456
Gene name Transmembrane p24 trafficking protein 6
Gene symbol TMED6
Synonyms (NCBI Gene)
PRO34237SPLL9146p24g5
Chromosome 16
Chromosome location 16q22.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005783 Component Endoplasmic reticulum IBA
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005789 Component Endoplasmic reticulum membrane IEA
GO:0005793 Component Endoplasmic reticulum-Golgi intermediate compartment IBA
GO:0005793 Component Endoplasmic reticulum-Golgi intermediate compartment IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WW62
Protein name Transmembrane emp24 domain-containing protein 6 (p24 family protein gamma-5) (p24gamma5)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01105 EMP24_GP25L 43 → 228 emp24/gp25L/p24 family/GOLD Domain
Sequence 
MSPLLFGAGLVVLNLVTSARSQKTEPLSGSGDQPLFRGADRYDFAIMIPPGGTECFWQFA
HQTGYFYFSYEVQRTVGMSHDRHVAATAHNPQGFLIDTSQGVRGQINFSTQETGFYQLCL
SNQHNHFGSVQVYLNFGVFYEGPETDHKQKERKQLNDTLDAIEDGTQKVQNNIFHMWRYY
NFARMRKMADFFLIQSNYNYVNWWSTAQSLVIILSGILQLYFLKRLFNVPTTTDTKKPRC
Sequence length 240
Interactions View interactions

No strongly related genes found yet for TMED6.

No additional diseases found yet through genes similar to TMED6.