TLX2 (T cell leukemia homeobox 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 3196
• Gene name: T cell leukemia homeobox 2
• Gene symbol: TLX2
• Synonyms (NCBI Gene): HOX11L1, NCX
• Chromosome: 2
• Chromosome location: 2p13.1
• Summary: This gene is a member of an orphan homeobox-containing transcription factor family. Studies of the mouse ortholog have shown that the encoded protein is crucial for the development of the enteric nervous system; in humans, loss-of-function may play a role

miRNA Show/Hide all (30)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1427076	hsa-miR-4252	CLIP-seq
MIRT1427077	hsa-miR-591	CLIP-seq
MIRT2127955	hsa-miR-1538	CLIP-seq
MIRT2127956	hsa-miR-4745-3p	CLIP-seq
MIRT2349597	hsa-miR-214	CLIP-seq
MIRT2349598	hsa-miR-3619-5p	CLIP-seq
MIRT2349599	hsa-miR-3922-5p	CLIP-seq
MIRT2349600	hsa-miR-3929	CLIP-seq
MIRT1427076	hsa-miR-4252	CLIP-seq
MIRT2349601	hsa-miR-4419b	CLIP-seq
MIRT2349602	hsa-miR-4478	CLIP-seq
MIRT2349603	hsa-miR-4530	CLIP-seq
MIRT2349604	hsa-miR-4690-5p	CLIP-seq
MIRT2349605	hsa-miR-4763-5p	CLIP-seq
MIRT1427077	hsa-miR-591	CLIP-seq
MIRT2349606	hsa-miR-761	CLIP-seq
MIRT2395866	hsa-miR-1973	CLIP-seq
MIRT2395867	hsa-miR-3160-3p	CLIP-seq
MIRT2395868	hsa-miR-3921	CLIP-seq
MIRT2395869	hsa-miR-4303	CLIP-seq
MIRT2395870	hsa-miR-4487	CLIP-seq
MIRT2395871	hsa-miR-4653-5p	CLIP-seq
MIRT2395872	hsa-miR-517b	CLIP-seq
MIRT2395873	hsa-miR-558	CLIP-seq
MIRT2441302	hsa-miR-1284	CLIP-seq
MIRT2441303	hsa-miR-3152-5p	CLIP-seq
MIRT2441304	hsa-miR-4774-3p	CLIP-seq
MIRT2441305	hsa-miR-4775	CLIP-seq
MIRT2441306	hsa-miR-582-5p	CLIP-seq
MIRT2441307	hsa-miR-590-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
PHOX2A	Activation	20044949
PHOX2B	Activation	16402914;20044949
PHOX2B	Unknown	17505528

Gene ontology (GO) Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	10869550
GO:0001707	Process	Mesoderm formation	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0043565	Function	Sequence-specific DNA binding	IDA	10869550
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10869550
GO:0048484	Process	Enteric nervous system development	IEA
GO:0048513	Process	Animal organ development	IBA
GO:0050774	Process	Negative regulation of dendrite morphogenesis	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 604240
• HGNC: 5057
• e!Ensembl: ENSG00000115297

Protein

• UniProt ID: O43763
• Protein name: T-cell leukemia homeobox protein 2 (Homeobox protein Hox-11L1) (Neural crest homeobox protein)
• Protein function: Transcription activator that binds DNA elements with the consensus sequence 5'-CGGTAATTGG-3'. Binds DNA via its homeobox. Required for normal cell death of enteric neurons in the gastrointestinal tract. Required for normal development of the ent
• PDB: 3A03
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00046	Homeodomain	158 → 214	Homeodomain	Domain

• Sequence:

  MEPGMLGPHNLPHHEPISFGIDQILSGPETPGGGLGLGRGGQGHGENGAFSGGYHGASGY
  GPAGSLAPLPGSSGVGPGGVIRVPAHRPLPVPPPAGGAPAVPGPSGLGGAGGLAGLTFPW
  MDSGRRFAKDRLTAALSPFSGTRRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQK
  YLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQTAEEREAERHRAGRLLLHLQQDALP
  RPLRPPLPPDPLCLHNSSLFALQNLQPWAEDNKVASVSGLASVV

• Sequence length: 284

Related Genes

No strongly related genes found yet for TLX2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to TLX2.