TLX1NB (TLX1 neighbor)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 100038246 |
| Gene name | TLX1 neighbor |
| Gene symbol | TLX1NB |
| Synonyms (NCBI Gene) |
APT-B7TD1TDI
|
| Chromosome | 10 |
| Chromosome location | 10q24.31 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
P0CAT3 |
| Protein name | Putative TLX1 neighbor protein (TLX1 divergent gene protein) |
| Family and domains | |
| Sequence |
MAPLQLLHPWGRRGAWASQHSLLSQEAMGPGEGAEPTPWGYLRAEHWGASPSGAPTLPFA |
| Sequence length | 122 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with TLX1NB across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to TLX1NB (see Related Genes above), that are NOT already directly curated for TLX1NB itself -- a lead worth checking, not a confirmed association.
0
|
|