TLR9 (toll like receptor 9)

Gene

• Entrez ID: 54106
• Gene name: Toll like receptor 9
• Gene symbol: TLR9
• Synonyms (NCBI Gene): CD289
• Chromosome: 3
• Chromosome location: 3p21.2
• Summary: The protein encoded by this gene is a member of the Toll-like receptor (TLR) family, which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and fun

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT736441	hsa-miR-491-3p	qRT-PCR, Flow cytometry	33679688
MIRT2349590	hsa-miR-125a-3p	CLIP-seq
MIRT2349591	hsa-miR-3194-3p	CLIP-seq
MIRT2349592	hsa-miR-3934	CLIP-seq
MIRT2349593	hsa-miR-4710	CLIP-seq
MIRT2349594	hsa-miR-592	CLIP-seq
MIRT2349595	hsa-miR-597	CLIP-seq
MIRT2349596	hsa-miR-764	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CEBPA	Unknown	15294971
CREB1	Unknown	15294971
ELF1	Unknown	15294971
ELK1	Unknown	15294971
ETS2	Unknown	15294971
HDAC3	Unknown	25194054
NFKB1	Unknown	25194054
PTMA	Repression	21176371;21575365
RELA	Unknown	25194054

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0001774	Process	Microglial cell activation	IEA
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0002218	Process	Activation of innate immune response	IEA
GO:0002224	Process	Toll-like receptor signaling pathway	IBA
GO:0002224	Process	Toll-like receptor signaling pathway	IDA	17128265
GO:0002224	Process	Toll-like receptor signaling pathway	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002639	Process	Positive regulation of immunoglobulin production	IDA	23857366
GO:0002730	Process	Regulation of dendritic cell cytokine production	IEA
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	IEA
GO:0005149	Function	Interleukin-1 receptor binding	IPI	12925853
GO:0005576	Component	Extracellular region	NAS	11130078
GO:0005737	Component	Cytoplasm	IDA	19740627
GO:0005764	Component	Lysosome	IEA
GO:0005764	Component	Lysosome	ISS
GO:0005768	Component	Endosome	IEA
GO:0005768	Component	Endosome	ISS
GO:0005783	Component	Endoplasmic reticulum	IDA	14716310
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	19740627
GO:0005886	Component	Plasma membrane	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007249	Process	Canonical NF-kappaB signal transduction	IBA
GO:0007249	Process	Canonical NF-kappaB signal transduction	IEA
GO:0008584	Process	Male gonad development	IEA
GO:0009615	Process	Response to virus	IEA
GO:0010008	Component	Endosome membrane	TAS
GO:0010508	Process	Positive regulation of autophagy	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	24409285
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	17128265
GO:0016324	Component	Apical plasma membrane	IDA	17128265
GO:0030277	Process	Maintenance of gastrointestinal epithelium	IEA
GO:0030277	Process	Maintenance of gastrointestinal epithelium	ISS
GO:0030890	Process	Positive regulation of B cell proliferation	IDA	23857366
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031901	Component	Early endosome membrane	IDA	14716310
GO:0031901	Component	Early endosome membrane	IEA
GO:0032009	Component	Early phagosome	IEA
GO:0032009	Component	Early phagosome	ISS
GO:0032481	Process	Positive regulation of type I interferon production	IDA	14703513
GO:0032490	Process	Detection of molecule of bacterial origin	IDA	17128265
GO:0032722	Process	Positive regulation of chemokine production	IDA	19740627
GO:0032725	Process	Positive regulation of granulocyte macrophage colony-stimulating factor production	IDA	24409285
GO:0032727	Process	Positive regulation of interferon-alpha production	IDA	16286015
GO:0032727	Process	Positive regulation of interferon-alpha production	IEA
GO:0032728	Process	Positive regulation of interferon-beta production	IDA	16286015
GO:0032728	Process	Positive regulation of interferon-beta production	IEA
GO:0032728	Process	Positive regulation of interferon-beta production	ISS
GO:0032728	Process	Positive regulation of interferon-beta production	TAS	16979567
GO:0032729	Process	Positive regulation of type II interferon production	IDA	16286015
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032733	Process	Positive regulation of interleukin-10 production	IEA
GO:0032733	Process	Positive regulation of interleukin-10 production	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	IEA
GO:0032735	Process	Positive regulation of interleukin-12 production	ISS
GO:0032741	Process	Positive regulation of interleukin-18 production	IEA
GO:0032741	Process	Positive regulation of interleukin-18 production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IBA
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	19740627, 24409285
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	17128265
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	19740627, 24409285
GO:0032757	Process	Positive regulation of interleukin-8 production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0034162	Process	Toll-like receptor 9 signaling pathway	IDA	23857366
GO:0034165	Process	Positive regulation of toll-like receptor 9 signaling pathway	IEA
GO:0035197	Function	SiRNA binding	IMP	15723075
GO:0036019	Component	Endolysosome	IEA
GO:0036019	Component	Endolysosome	ISS
GO:0036020	Component	Endolysosome membrane	IEA
GO:0036020	Component	Endolysosome membrane	TAS
GO:0038187	Function	Pattern recognition receptor activity	IBA
GO:0038187	Function	Pattern recognition receptor activity	IDA	14716310, 17128265
GO:0042742	Process	Defense response to bacterium	NAS	11130078
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	17128265, 19740627
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	23857366
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	TAS	15356140
GO:0045322	Function	Unmethylated CpG binding	IEA
GO:0045322	Function	Unmethylated CpG binding	ISS
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0045577	Process	Regulation of B cell differentiation	IDA	23857366
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IDA	17128265
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IDA	19740627
GO:0050829	Process	Defense response to Gram-negative bacterium	IMP	22427638
GO:0050864	Process	Regulation of B cell activation	IEA
GO:0050871	Process	Positive regulation of B cell activation	IDA	23857366
GO:0051607	Process	Defense response to virus	IBA
GO:0051607	Process	Defense response to virus	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071248	Process	Cellular response to metal ion	IEA
GO:0098542	Process	Defense response to other organism	IEA
GO:0140894	Process	Endolysosomal toll-like receptor signaling pathway	IEA
GO:1901895	Process	Negative regulation of ATPase-coupled calcium transmembrane transporter activity	IDA	24610369
GO:1902350	Process	Cellular response to chloroquine	IEA
GO:1905300	Process	Positive regulation of intestinal epithelial cell development	IEA
GO:1905300	Process	Positive regulation of intestinal epithelial cell development	ISS

Other IDs

• MIM: 605474
• HGNC: 15633
• e!Ensembl: ENSG00000239732

Protein

• UniProt ID: Q9NR96
• Protein name: Toll-like receptor 9 (CD antigen CD289)
• Protein function: Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR9 is a nucleotide-sensing TLR which is activated by
• PDB: 8AR3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13855	LRR_8	50 → 98	Leucine rich repeat	Repeat
  PF13855	LRR_8	290 → 345	Leucine rich repeat	Repeat
  PF18837	LRR_12	393 → 422	Leucine-rich repeat	Repeat
  PF13855	LRR_8	701 → 762	Leucine rich repeat	Repeat
  PF01582	TIR	870 → 1030	TIR domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in spleen, lymph node, tonsil and peripheral blood leukocytes, especially in plasmacytoid pre-dendritic cells. Levels are much lower in monocytes and CD11c+ immature dendritic cells. Also detected in lung and liver.
• Sequence:

  MGFCRSALHPLSLLVQAIMLAMTLALGTLPAFLPCELQPHGLVNCNWLFLKSVPHFSMAA
  PRGNVTSLSLSSNRIHHLHDSDFAHLPSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTFL
  AVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYY
  KNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYLLLSYNRIVKLAPEDL
  ANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
  ASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNYQKRVSFAHLSLAPSF
  GSLVALKELDMHGIFFRSLDETTLRPLARLPMLQTLRLQMNFINQAQLGIFRAFPGLRYV
  DLSDNRISGASELTATMGEADGGEKVWLQPGDLAPAPVDTPSSEDFRPNCSTLNFTLDLS
  RNNLVTVQPEMFAQLSHLQCLRLSHNCISQAVNGSQFLPLTGLQVLDLSHNKLDLYHEHS
  FTELPRLEALDLSYNSQPFGMQGVGHNFSFVAHLRTLRHLSLAHNNIHSQVSQQLCSTSL
  RALDFSGNALGHMWAEGDLYLHFFQGLSGLIWLDLSQNRLHTLLPQTLRNLPKSLQVLRL
  RDNYLAFFKWWSLHFLPKLEVLDLAGNQLKALTNGSLPAGTRLRRLDVSCNSISFVAPGF
  FSKAKELRELNLSANALKTVDHSWFGPLASALQILDVSANPLHCACGAAFMDFLLEVQAA
  VPGLPSRVKCGSPGQLQGLSIFAQDLRLCLDEALSWDCFALSLLAVALGLGVPMLHHLCG
  WDLWYCFHLCLAWLPWRGRQSGRDEDALPYDAFVVFDKTQSAVADWVYNELRGQLEECRG
  RWALRLCLEERDWLPGKTLFENLWASVYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLE
  DRKDVVVLVILSPDGRRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHF
  YNRNFCQGPTAE

• Sequence length: 1032

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Esophageal atresia/tracheoesophageal fistula	Likely pathogenic	rs780099835	RCV001172304	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHIOLITIS OBLITERANS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC FIBROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS B	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS C	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS NEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIPLE NEGATIVE BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acne	Acne	BEFREE	15778393		★☆☆☆☆ Found in Text Mining only
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	28973009		★☆☆☆☆ Found in Text Mining only
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	28373582		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	31530240		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	27277333		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	22415665, 30106134, 31726046		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	29968427		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23913633		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	22371291		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27277333		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	19745833		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	19953283		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	28228119		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	22932083, 31571275		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	31571275		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17652175, 23957925, 37433968	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	28410407		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	16779724, 20348392, 22078797, 23045477, 30630901		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	LHGDN	16779724		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	20348392, 23045477, 34161457	Associate	★☆☆☆☆ Found in Text Mining only
Angioedemas Hereditary	Angioedema	Pubtator	22288585	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	21833528		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	22832815		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	GWASCAT_DG	29942085		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	22832815		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	26751387, 30905257		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	18060042, 29992753, 31737959		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	31279905	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	16507115, 31781672	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15383579, 19384869, 24936783, 26759164, 28677621, 33377396, 34635730, 36405992	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	15843591, 16164440, 18312481, 19096003, 19130296, 20072849, 20623989, 21324137, 24722226, 28252235, 30914379		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	18312481		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	20038537, 24375473	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	16849519		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	16849519	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	26751387, 30905257		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	15307186, 15383579, 17075805, 23289794, 24375473, 28766555, 31790283	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	15730519, 16027240, 18613842, 19648272, 20810248, 21287547, 22024499, 23467932, 24255044, 24352680, 25248338, 26723518, 27432810, 28049380, 28530246, 28751890, 29118245, 29363775, 29434596, 29889098, 30813872, 30833557, 30900780, 31790283		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	22717578, 23287859, 23727784, 26448050		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	15746051, 26136429, 28083607, 30068596		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	29889098		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	17854429, 23065292		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	23237868, 37264476	Associate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	31090157		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	17075576	Associate	★☆☆☆☆ Found in Text Mining only
Birdshot Chorioretinopathy	Birdshot chorioretinopathy	Pubtator	20140383	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23142523, 25499923		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	16906541		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16849519, 17373717, 18922969, 19724876, 19810822, 20156214, 21129170, 21607583, 26780557, 27187369, 27888633, 28106541, 28432455, 28886076, 31091800, 31205871		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16849519, 20156214, 20375566, 21129170, 23634849, 27187369, 28106541, 28886076, 31789409, 33046620, 37771087, 40550227	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	Pubtator	18684966	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	27498757, 29253610		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	27498757, 29253610	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	12689944, 22717578, 29088270	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	15894327, 20514021, 22717578		★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	30610800	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25400780, 37843556	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	20978888, 21876325, 25338738		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22046272	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33407720	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23142523, 25499923		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18763053, 19302975, 19854217, 23913633, 24788552, 30431116, 30502651		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31314777	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	21929816	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21527067	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21876325	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	20156214, 30643427		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	30364002		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	18692642	Inhibit	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	32076951	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	28295589	Associate	★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	27725770		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	23844808, 30057921		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	23844808	Stimulate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	30057921	Associate	★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia, Mental Retardation, And Dysequilibrium Syndrome 1	Cerebellar Ataxia, Mental Retardation, And Dysequilibrium Syndrome	BEFREE	25817729		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21132533, 22059466, 22714906, 23816930, 26270118, 26548749, 28459195, 28819773, 30147445, 30215163, 31278284, 31796857		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	21527067		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21132533, 22059466, 22714906, 23816930, 26270118, 26548749, 28459195, 30147445, 30215163, 31278284, 31796857		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	27277333		★☆☆☆☆ Found in Text Mining only
Childhood Ataxia with Central Nervous System Hypomyelinization	Leukoencephalopathy with vanishing white matter	BEFREE	29889098		★☆☆☆☆ Found in Text Mining only
Choledochal Cyst	Cholecystolithiasis	Pubtator	17075576	Associate	★☆☆☆☆ Found in Text Mining only
Chorioretinitis	Chorioretinitis	BEFREE	20140383		★☆☆☆☆ Found in Text Mining only
Chromosome 11p11.2 Deletion Syndrome	11p11.2 Deletion Syndrome	BEFREE	31465768		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	23472199	Associate	★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	25175493		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	23472199		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	21908957		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15746051, 20339095, 20581863, 21812536, 22343732, 23276930, 24144314, 26136429, 28083607, 29034364, 29450641, 30068596, 30723588		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	22836641, 26361369, 27288485		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	20041977		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	23406596, 29901280, 30056130		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	29427373		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	29196629	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	15765149, 21762664		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	30227886	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	21155002, 22185629, 24971461	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17636117, 23467704, 30271180		★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	31450898	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22371291, 25546690, 28106541, 29883450, 30239551, 30271180		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25546690, 26889036, 28106541, 28766555, 29883450, 30239551, 35651701	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	16424230, 21548449, 22048980, 24051380, 28973009, 30145329, 30698158		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	19592080, 22048980, 22454615, 28973009, 37626865, 37896869	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	20667457, 25535670, 29276096, 31798696		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28490840		★☆☆☆☆ Found in Text Mining only
Corneal Ulcer	Corneal ulcer	Pubtator	23750216	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	17283572, 21720175, 23406596, 29901280		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	CTD_human_DG	15236225, 17914947		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	15928043, 15996194, 17914947, 19455129, 24776844, 24971461, 30193869		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	15928043, 21752155, 24971461	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	32872480	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn`s disease of large bowel	Crohn`s Disease Of Large Bowel	CTD_human_DG	15236225, 17914947		★☆☆☆☆ Found in Text Mining only
Crohn`s disease of the ileum	Crohn`s Disease Of The Ileum	CTD_human_DG	15236225, 17914947		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	18684966, 23406596		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic fibrosis	Pubtator	18684966	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystitis	Cystitis	BEFREE	29686303		★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	26938157, 28321710		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	21748790, 24237425, 28916728		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	15655803		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	19639721	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	17573724, 21112617		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	17573724		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	19953283		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	19953283, 36564154	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	25586463, 30094467		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	25586463, 28874301, 30094467		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	25586463	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	25333705, 33029194, 37139337	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	25586463	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28445304, 31073344	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30094467		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	25586463, 26525587, 28445304		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic Foot	BEFREE	28445304		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	28445304	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28647749		★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	30227886	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	30446590, 31402495		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	21050493		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	23169882	Stimulate	★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	25995217		★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal ulcer	Pubtator	25995217	Associate	★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	20610663	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	21112617		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	29116594	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	20646321		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	20646321	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	20646321	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	23935397	Stimulate	★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	29691386		★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	29691386	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24647486		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	24647486		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	29968427	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	21876325, 29968427	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	21990957	Stimulate	★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	34161457	Associate	★☆☆☆☆ Found in Text Mining only
Eye Diseases	Eye disease	Pubtator	20140383	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	31795627	Inhibit	★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	31388096	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	26808498, 31388096		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	18760996, 28093541		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	19337058		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	19337058, 32719215	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	29968427	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	21050493	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	16849519	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	18253698, 20696081, 22169598, 27744078		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	18253698		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	18253698, 20696081, 22169598, 27744078, 30721028		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	16906541, 18253698, 20696081, 21756999, 22169598, 27538656		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	20696081	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	23564191, 28356164, 29687651		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	36233099	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	24586974, 25293716, 27920152, 29403161, 31088610, 31489594, 36233099	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	27818460	Stimulate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	23964786	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis, Membranoproliferative	Glomerulonephritis	BEFREE	30592438		★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	22948541	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	23022388, 29142307	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	23592712		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	28013570		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	28013570	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	21050493	Associate	★☆☆☆☆ Found in Text Mining only
Hamman-Rich syndrome	Hamman-Rich syndrome	BEFREE	18633634		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	39508448	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	22662111	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28490840		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	23287859, 31599020		★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	LHGDN	17894360		★☆☆☆☆ Found in Text Mining only
Heme Oxygenase 1 Deficiency	Heme Oxygenase 1 Deficiency	BEFREE	28052108		★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	21220755	Associate	★☆☆☆☆ Found in Text Mining only
Hemophagocytic Syndrome	Hemophagocytic Syndrome	BEFREE	28034913		★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	33852451	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	24168509	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis B Chronic	Hepatitis b	Pubtator	22046272, 24168509	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	28093541, 30232187, 31279905, 31969220, 35575727	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis Chronic	Hepatitis	Pubtator	22046272	Inhibit	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	20156214	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	19745833		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	35905120	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	23326634, 28554874		★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	BEFREE	29427373		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	34479492	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	29274721		★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	21670437, 23608825		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	18633634, 22344343		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	18633634, 21068441	Associate	★☆☆☆☆ Found in Text Mining only
IgA Deficiency	Selective immunoglobulin a deficiency	Pubtator	29755476	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	18776126, 21778277, 24756968, 24993857, 25293716, 27818460, 27920152, 31088610, 31748116		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IIeocolitis	Ileocolitis	CTD_human_DG	15236225, 17914947		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	22948541		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	22948541	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	40062898	Stimulate	★☆☆☆☆ Found in Text Mining only
Immunoglobulin A deficiency (disorder)	Immunoglobulin A deficiency	BEFREE	29755476		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	17954572, 28062211		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myopathy, Sporadic	Inclusion body myopathy	BEFREE	23608825		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	26568059	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	19275920, 19455129, 25544730, 26632396, 27417569, 27590109, 29718255, 30193869, 30617966		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	20038537, 24971461	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	29142307	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	36248807	Associate	★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	23651260		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	21752155	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	28246611		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	28246611	Stimulate	★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	30429335		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	16926427, 20419141		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	20810248, 23472199, 24993857		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	21220755, 23472199	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	19684120, 21748790, 23472199	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	23548820, 29898963, 30777286, 31760767		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	23472199		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	21478107	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	20132814, 26796361, 31530240		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	27706246, 40516328	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	20814675, 25605370, 36076988	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	23287859, 25412934, 26796361, 26919710		★☆☆☆☆ Found in Text Mining only
Leukoplakia	Leukoplakia	BEFREE	31129425		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	22853846, 24658023, 25338738		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20811701, 22046272, 22309608, 23467704, 24452201, 25224571, 25681553, 28370295, 28875549		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	29427373		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Alcoholic	Liver cirrhosis	Pubtator	19737238	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	29147012		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	21937948, 27026438	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	22836641		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	32602227	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	35997276	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	31821687		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	15631627, 17986857, 28893372	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17986857, 18568766		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	29945961		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	16027240, 16973389, 17469139, 18034431, 18241699, 18373699, 18613842, 19362685, 20810248, 22932083, 23467932, 23974051, 24865418, 25466615, 27432810, 28278279, 29632142, 29687651, 30286201, 30540579		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	38004071	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15307186, 15383579, 18321389, 18373699, 19079358, 22513098, 22697500, 22948541, 22952899, 24375473, 24692849, 25485543, 25638528, 26457008, 28763101, 29515028, 30210502, 31022289, 31085070, 31647295, 33336388, 34161457, 34596588, 35833144, 37840148	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17075805, 19843090, 22620859, 27424138	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	16027240, 16973389, 17469139, 18034431, 18241699, 18373699, 18613842, 19362685, 20810248, 23467932, 23974051, 24865418, 25466615, 27432810, 28278279, 29632142, 29687651, 30286201, 30540579		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	15730519, 16027240, 16575840, 16973389, 17341193, 17344245, 17469139, 17516623, 18034431, 18160420, 18241699, 18373699, 18613842, 19130296, 19362685, 19648272, 20605877, 20619604, 20810248, 21250838, 21287547, 21499878, 22065095, 22178715, 22228476, 22325161, 22620859, 22932083, 22948541, 23467932, 23564191, 23974051, 24004541, 24865418, 24919757, 25182168, 25466615, 25695778, 26457008, 26643792, 26762473, 27018624, 27432810, 28049380, 28278279, 28528372, 28544067, 28763101, 29052537, 29515028, 29632142, 29687651, 29889098, 30034390, 30210502, 30286201, 30540579, 30610165, 30936294, 30937000, 31546246, 31647295		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	17075805, 17295441, 17516623		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	BEFREE	16575840, 17469139, 20497632, 20619604, 20810248, 28763101, 31002145		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	LHGDN	17469139		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus nephritis	Pubtator	27635115	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus nephritis	Pubtator	28763101, 31002145, 33354779, 35392757, 40011954	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Vulgaris	Lupus Vulgaris	BEFREE	16027240, 16973389, 17469139, 18034431, 18241699, 18373699, 18613842, 19362685, 20810248, 23467932, 23974051, 24865418, 25466615, 27432810, 28278279, 29632142, 29687651, 30286201, 30540579		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21527067, 26087186, 29968427	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21876325, 24504675, 34643549	Associate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	28034913		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	LHGDN	17768129		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	17675511, 29956749		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	20697067, 20963937	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	12689944, 19519691, 24771328	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	24912772		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	21866115, 24912772, 29433938		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	21866115, 24912772, 29433938		★☆☆☆☆ Found in Text Mining only
Macrophage Activation Syndrome	Macrophage Activation Syndrome	BEFREE	28034913, 29295842, 30073799		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	27538656		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16849519, 17373717, 18922969, 19724876, 19810822, 20156214, 21129170, 21607583, 22847512, 26780557, 27187369, 27888633, 28106541, 28432455, 28886076, 31091800, 31205871		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	20646321		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	24647486		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	23082743		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18763053, 19302975, 19854217, 23913633, 24788552, 30431116, 30502651		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	22853846, 24658023, 25338738		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	20156214, 30643427		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21448350, 21890455		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17373717, 19618291, 20978888, 25967142, 26087186, 30337279, 31090157		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16786156, 19337058, 31083432, 31798780		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23142523, 25499923		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16339564, 16428503, 16849519, 17179105, 18020622, 18763053, 18922969, 20156214, 20423229, 20623989, 20696081, 20811701, 21607583, 22169598, 22717578, 22847512, 23561041, 23727784, 23990988, 24212717, 24788552, 25224571, 25339018, 25369757, 25646304, 27157617, 27402288, 28012777, 28106541, 28151089, 28186087, 28214929, 28241765, 28766555, 28875549, 29588348, 29679570, 29968427, 30120629, 30154193, 30239551, 30429335, 30623441, 31129425, 31278284, 31300344, 31450898, 31798780		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21132533, 22059466, 22714906, 23816930, 26270118, 26548749, 28459195, 30147445, 30215163, 31278284, 31796857		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17636117, 30271180		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16849519, 18922969		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	29909409		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	17179105, 29669722		★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	23964786		★☆☆☆☆ Found in Text Mining only
Mixed Connective Tissue Disease	Mixed connective tissue disease	Pubtator	33336388	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	27157617	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	22853846, 24658023	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	25780885, 28061462	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12689944, 20629663, 23593278	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	18208876, 21061396, 23731219, 28131238, 29146546, 29168181, 31136008		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	19664140, 20227772, 20621365, 21061396, 23950974, 29168181	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	27609294		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	22898741, 26723518, 29331804, 29363775		★☆☆☆☆ Found in Text Mining only
MYD88 Deficiency	MYD88 Deficiency	BEFREE	29118245		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	20132814		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	36835307	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29057537, 29605419, 31209243		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	31279856		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	23608825	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	27018624, 29632021		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	34830017	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	17283572, 21720175, 23406596, 29901280, 30056130		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	25133733	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	24504675, 25891128, 29250178		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	24504675, 31886298	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	19109197		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	19109197, 30480807		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14559840, 16024642, 16531815, 16818518, 17179105, 17636117, 17675511, 18763053, 19724876, 20067543, 20156214, 20935225, 20978888, 21129170, 21527067, 21876325, 21878529, 22717578, 22847512, 22853846, 23221735, 23484053, 23521528, 23913633, 24212717, 24647486, 24788552, 25081715, 25168392, 25224571, 25546690, 25681553, 25941114, 27538656, 27744078, 28012777, 28106541, 28370295, 28886076, 28982847, 29588348, 29605400, 29945961, 29968427, 30271180, 30337279, 30546946, 31090157, 31093508, 31619293, 31771649, 31798780		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	16027240, 27818460		★☆☆☆☆ Found in Text Mining only
Nephrosis congenital	Nephrotic syndrome	Pubtator	27355219	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	20935225		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	27716850	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30076830		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	31229737		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	28929859		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16818518, 23913633, 29945961		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	26808498		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	27018624		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26808498	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29132311, 36552771	Associate	★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Obesity	Pubtator	31388096	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	22847512		★☆☆☆☆ Found in Text Mining only
Optic Neuropathy	Optic Neuropathy	BEFREE	28647749		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	21748790, 23255072, 28295589	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	21748790, 23255072, 28295589, 28916728	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	21748790, 23255072, 28295589		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	27795360		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26504005		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	36450527	Associate	★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	21239460, 24882571		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	20156214, 30643427		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	30610800, 35464051, 35577351, 36231099	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	20473889, 21448350		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28191612		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	16024642, 21448350		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21448350, 27941651	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30813872		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	37518875	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	22552867, 26000920, 29934589		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	33382388	Inhibit	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	33382388	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal Nonkinesigenic Dyskinesia 1	Paroxysmal nonkinesigenic dyskinesia	BEFREE	21191414		★☆☆☆☆ Found in Text Mining only
PEELING SKIN SYNDROME	Peeling Skin Syndrome	BEFREE	31465768		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	27849177, 30465884		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	20041977, 24476546, 25037760, 27492306, 27795360, 27849177, 29791566, 30636333, 31737959		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	25037760	Associate	★☆☆☆☆ Found in Text Mining only
Pharyngitis	Pharyngitis	BEFREE	28929859		★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	BEFREE	27018624, 31836766		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	19953283, 21670437, 31821687		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	19953283	Associate	★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	31450898		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	15878652		★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	23710539	Associate	★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	17408653, 25160604		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17373717, 19618291, 20978888, 25967142, 26087186, 30337279, 31090157		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	31090157	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17373717		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19505919, 20978888, 25967142, 26087186, 31090157, 34643549, 36613950	Associate	★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	27818460, 31489594	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	18613842, 19648272, 21850017, 22555189, 25561051		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	27018624		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	34161457	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22070100	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	37585174	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	27288485		★☆☆☆☆ Found in Text Mining only
Purpura, Thrombotic Thrombocytopenic	Thrombotic thrombocytopenic purpura	BEFREE	23711330		★☆☆☆☆ Found in Text Mining only
Rasmussen Syndrome	Rasmussen`s Syndrome	BEFREE	29116594		★☆☆☆☆ Found in Text Mining only
Regional enteritis	Crohn Disease	CTD_human_DG	15236225, 17914947		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19384869, 20422193, 24936783, 30417696, 30636333, 31737959		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	20416452	Stimulate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	28228119	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	20659127	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	22836641		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22832610, 30616121		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	22832610	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	31043596, 33168071, 33336388	Associate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	26889036, 28569041		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	28202935	Associate	★☆☆☆☆ Found in Text Mining only
Selective immunoglobulin A deficiency	Selective Immunoglobulin A Deficiency	BEFREE	29755476		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	19252531, 21633947, 23548820, 25412934, 25944792, 27566084, 29506272, 30348730, 30364002, 31380807, 31534550, 31760767		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	31300344	Associate	★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	Pubtator	20416452	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	26332048, 30846988	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	27943374	Inhibit	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	35715478	Stimulate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	17229603		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	32076951	Stimulate	★☆☆☆☆ Found in Text Mining only
SMITH-MCCORT DYSPLASIA 1	Smith-McCort Dysplasia	BEFREE	28152051		★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	31781672		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	31781672	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21876325, 23651260, 24658023, 24676671, 25338738		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	21876325, 21990957		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22853846, 24658023, 31379843, 34479492, 35990685	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31379843		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16786156, 19337058, 23776537, 25843196, 31083432, 31798780		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach Diseases	BEFREE	20038537		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	20038537, 32719215	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23776537, 25400780, 30618438, 31467388, 35635169	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27157617	Stimulate	★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	33377396	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29076114, 29147913, 31043596, 31465768		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	28321710		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	21050493		★☆☆☆☆ Found in Text Mining only
Trichotillomania	Trichotillomania	BEFREE	31571275		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22847512, 28886076		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28886076	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	BEFREE	19455129, 21155002, 22185629, 24776844, 24971461, 30120066, 31630153		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	21527067, 25081715	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	25124588	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	BEFREE	23221735, 28819773		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	22714906, 23221735, 23816930, 25081715, 26270118, 26548749, 28819773, 31278284, 37843556	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25124588, 25309919	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervicitis	Uterine Cervicitis	BEFREE	31365550		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	26751387		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	23065292		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	24773611, 29923769, 31790283	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	28321710	Associate	★☆☆☆☆ Found in Text Mining only
X-linked agammaglobulinemia	Agammaglobulinemia, X-Linked	BEFREE	17932028, 24612681, 30698158		★☆☆☆☆ Found in Text Mining only