Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	59274
Gene name	Talin rod domain containing 1
Gene symbol	TLNRD1
Synonyms (NCBI Gene)	MESDC1
Chromosome	15
Chromosome location	15q25.1
Summary	This gene encodes a protein that is regulated by micro RNA MiR-574-3, and is thought to have an oncogenic function in human bladder cancer. A similar gene in mouse is located in a chromosomal region critical for differentiation of mesoderm, which affects

32 Show/Hide all (32)

miRTarBase ID	miRNA	Experiments	Reference
MIRT656318	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT656317	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT656315	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT656316	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT656314	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT656313	hsa-miR-4287	HITS-CLIP	23824327
MIRT656311	hsa-miR-1260a	HITS-CLIP	23824327
MIRT656310	hsa-miR-1260b	HITS-CLIP	23824327
MIRT656309	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT656308	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT656318	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT656317	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT656315	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT656316	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT656314	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT656313	hsa-miR-4287	HITS-CLIP	23824327
MIRT656312	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT656311	hsa-miR-1260a	HITS-CLIP	23824327
MIRT656310	hsa-miR-1260b	HITS-CLIP	23824327
MIRT656309	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT656308	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT535980	hsa-miR-216a-3p	PAR-CLIP	22012620
MIRT535978	hsa-miR-128-3p	PAR-CLIP	22012620
MIRT535977	hsa-miR-27a-3p	PAR-CLIP	22012620
MIRT535976	hsa-miR-27b-3p	PAR-CLIP	22012620
MIRT535975	hsa-miR-3681-3p	PAR-CLIP	22012620
MIRT535974	hsa-miR-574-3p	PAR-CLIP	22012620
MIRT535973	hsa-miR-548aw	PAR-CLIP	22012620
MIRT535972	hsa-miR-518a-5p	PAR-CLIP	22012620
MIRT535971	hsa-miR-527	PAR-CLIP	22012620
MIRT535970	hsa-miR-3679-3p	PAR-CLIP	22012620
MIRT535969	hsa-miR-450b-5p	PAR-CLIP	22012620

7 Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001725	Component	Stress fiber	IEA
GO:0001725	Component	Stress fiber	ISS
GO:0003779	Function	Actin binding	IBA
GO:0003779	Function	Actin binding	IEA
GO:0003779	Function	Actin binding	ISS
GO:0005515	Function	Protein binding	IPI	32296183, 33961781
GO:0042802	Function	Identical protein binding	IPI	32296183

MIM	HGNC	e!Ensembl
615466	13519	ENSG00000140406

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q9H1K6
Protein name	Talin rod domain-containing protein 1 (Mesoderm development candidate 1)
Protein function	Actin-binding protein which may have an oncogenic function and regulates cell proliferation, migration and invasion in cancer cells.
PDB	6XZ3 , 6XZ4
Family and domains
Sequence	MASGSAGKPTGEAASPAPASAIGGASSQPRKRLVSVCDHCKGKMQLVADLLLLSSEARPV LFEGPASSGAGAESFEQCRDTIIARTKGLSILTHDVQSQLNMGRFGEAGDSLVELGDLVV SLTECSAHAAYLAAVATPGAQPAQPGLVDRYRVTRCRHEVEQGCAVLRATPLADMTPQLL LEVSQGLSRNLKFLTDACALASDKSRDRFSREQFKLGVKCMSTSASALLACVREVKVAPS ELARSRCALFSGPLVQAVSALVGFATEPQFLGRAAAVSAEGKAVQTAILGGAMSVVSACV LLTQCLRDLAQHPDGGAKMSDHRERLRNSACAVSEGCTLLSQALRERSSPRTLPPVNSNS VN
Sequence length	362
Interactions	View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Long QT syndrome	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (7)
Bladder Neoplasm	Bladder Neoplasm	BEFREE	22179486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	22179486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	38326615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27881003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	22179486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22179486, 27881003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	22179486	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with TLNRD1 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for TLNRD1.

Diseases Linked via Similar Genes Diseases curated for genes most similar to TLNRD1 (see Related Genes above), that are NOT already directly curated for TLNRD1 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to TLNRD1.

TLNRD1 (talin rod domain containing 1)

Bookmark This Gene