TLE7 (TLE family member 7)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 102723796
Gene name TLE family member 7
Gene symbol TLE7
Synonyms (NCBI Gene)
chico
Chromosome 16
Chromosome location 16q22.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003714 Function Transcription corepressor activity IBA
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005667 Component Transcription regulator complex IBA
GO:0006355 Process Regulation of DNA-templated transcription IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A1W2PR48
Protein name Transducin-like enhancer protein 7
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00400 WD40 146 → 185 WD domain, G-beta repeat Repeat
Sequence 
MSGEKEEASLRMFGAYGEPEERRDVLESSGVSSQPEPQVQQQLGSLLGVPWQPPGPPIQH
SPADQETSTVTQQQWHLQGLGRSELQAAGLPDAQPGEAAESSPSFLLGSEVGQPYSSSSP
SEEVLSLLRAIPPIPDEVVVRQKRAPQGSWKVGTLFHGKRVYAVAISGSTHHVYTCGSGY
IRVWDESALHAGEKAPRAQLDLQHPQDRVVTCKLFPDERSLITGGASQAVTLWDLAPTPQ
VRAQLTSTGPTCYSLAVSSDAHICLACFHGFVEIWDLQNQILIRKHEVPVYGSRCVDITG
NIFWTGGEDTILYSWDLRSYQRLHQHNLQNEILSITHDPGEEWVLAGLRTSDIVFLHTRR
NEQFKALMKKYTRHHSLKFASCGSYFVTAIDTRLSGLEAPSLQKLFQIEESSGILCCDVS
SDNQYLVMGSSSSATIYQLLY
Sequence length 441
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Wnt signaling pathway
Notch signaling pathway
Sort by:
TLE6 2 shared pathwaysWnt signaling pathway, Notch signaling pathway Related via 2 shared pathways including Wnt signaling pathway, Notch signaling pathway. CTBP2 2 shared pathwaysWnt signaling pathway, Notch signaling pathway Related via 2 shared pathways including Wnt signaling pathway, Notch signaling pathway. TLE1 2 shared pathwaysWnt signaling pathway, Notch signaling pathway Related via 2 shared pathways including Wnt signaling pathway, Notch signaling pathway. TLE2 2 shared pathwaysWnt signaling pathway, Notch signaling pathway Related via 2 shared pathways including Wnt signaling pathway, Notch signaling pathway. TLE4 2 shared pathwaysWnt signaling pathway, Notch signaling pathway Related via 2 shared pathways including Wnt signaling pathway, Notch signaling pathway.
Diabetes mellitus type 2 Linked via 3 of 5 related genesCTBP2, TLE1, TLE4 Metabolic syndrome Linked via 2 of 5 related genesCTBP2, TLE4 Female infertility Linked via 1 of 5 related genesTLE6 Oligodendroglioma Linked via 1 of 5 related genesTLE6 Oocyte maturation defect Linked via 1 of 5 related genesTLE6