TLCD1 (TLC domain containing 1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 116238
• Gene name: TLC domain containing 1
• Gene symbol: TLCD1
• Synonyms (NCBI Gene): -
• Chromosome: 17
• Chromosome location: 17q11.2

miRNA Show/Hide all (12)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1426054	hsa-miR-3591-5p	CLIP-seq
MIRT1426055	hsa-miR-4255	CLIP-seq
MIRT1426056	hsa-miR-4257	CLIP-seq
MIRT1426057	hsa-miR-1197	CLIP-seq
MIRT1426058	hsa-miR-185	CLIP-seq
MIRT1426059	hsa-miR-3176	CLIP-seq
MIRT1426060	hsa-miR-3922-3p	CLIP-seq
MIRT1426056	hsa-miR-4257	CLIP-seq
MIRT1426061	hsa-miR-4306	CLIP-seq
MIRT1426062	hsa-miR-4644	CLIP-seq
MIRT1426063	hsa-miR-4757-5p	CLIP-seq
MIRT1426064	hsa-miR-485-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	30509349
GO:0005886	Component	Plasma membrane	IEA
GO:0007009	Process	Plasma membrane organization	IBA
GO:0007009	Process	Plasma membrane organization	IMP	30509349
GO:0016020	Component	Membrane	IEA
GO:0055091	Process	Phospholipid homeostasis	IBA
GO:0055091	Process	Phospholipid homeostasis	IMP	30509349
GO:0071709	Process	Membrane assembly	IBA
GO:0071709	Process	Membrane assembly	IMP	30509349
GO:0097035	Process	Regulation of membrane lipid distribution	IBA
GO:0097035	Process	Regulation of membrane lipid distribution	IMP	30509349

Other IDs

• MIM: 620966
• HGNC: 25177
• e!Ensembl: ENSG00000160606

Protein

• UniProt ID: Q96CP7
• Protein name: TLC domain-containing protein 1 (Calfacilitin)
• Protein function: Regulates the composition and fluidity of the plasma membrane (PubMed:30509349). Inhibits the incorporation of membrane-fluidizing phospholipids containing omega-3 long-chain polyunsaturated fatty acids (LCPUFA) and thereby promotes membrane rig
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03798	TRAM_LAG1_CLN8	44 → 227	TLC domain	Domain

• Sequence:

  MPRLLHPALPLLLGATLTFRALRRALCRLPLPVHVRADPLRTWRWHNLLVSFAHSIVSGI
  WALLCVWQTPDMLVEIETAWSLSGYLLVCFSAGYFIHDTVDIVASGQTRASWEYLVHHVM
  AMGAFFSGIFWSSFVGGGVLTLLVEVSNIFLTIRMMMKISNAQDHLLYRVNKYVNLVMYF
  LFRLAPQAYLTHFFLRYVNQRTLGTFLLGILLMLDVMIIIYFSRLLRSDFCPEHVPKKQH
  KDKFLTE

• Sequence length: 247

Related Genes

No strongly related genes found yet for TLCD1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to TLCD1.