Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	114609
Gene name	TIR domain containing adaptor protein
Gene symbol	TIRAP
Synonyms (NCBI Gene)	BACTS1MalMyD88-2wyatt
Chromosome	11
Chromosome location	11q24.2
Summary	The innate immune system recognizes microbial pathogens through Toll-like receptors (TLRs), which identify pathogen-associated molecular patterns. Different TLRs recognize different pathogen-associated molecular patterns and all TLRs have a Toll-interleuk

256

Show/Hide all (256)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004748	hsa-miR-145-5p	ImmunoprecipitaionWestern blotCommunoprecipitaion	19898489
MIRT674506	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT674505	hsa-miR-764	HITS-CLIP	23824327
MIRT674504	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT674503	hsa-miR-4635	HITS-CLIP	23824327
MIRT674502	hsa-miR-4680-5p	HITS-CLIP	23824327
MIRT674501	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT674500	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT674499	hsa-miR-4755-3p	HITS-CLIP	23824327
MIRT674498	hsa-miR-8086	HITS-CLIP	23824327
MIRT674497	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT674496	hsa-miR-7158-3p	HITS-CLIP	23824327
MIRT674495	hsa-miR-203b-3p	HITS-CLIP	23824327
MIRT674494	hsa-miR-640	HITS-CLIP	23824327
MIRT674493	hsa-miR-548s	HITS-CLIP	23824327
MIRT674491	hsa-miR-588	HITS-CLIP	23824327
MIRT674490	hsa-miR-4435	HITS-CLIP	23824327
MIRT674489	hsa-miR-3187-3p	HITS-CLIP	23824327
MIRT674488	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT674487	hsa-miR-3157-5p	HITS-CLIP	23824327
MIRT674506	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT674505	hsa-miR-764	HITS-CLIP	23824327
MIRT674504	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT674503	hsa-miR-4635	HITS-CLIP	23824327
MIRT674502	hsa-miR-4680-5p	HITS-CLIP	23824327
MIRT674501	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT674500	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT674499	hsa-miR-4755-3p	HITS-CLIP	23824327
MIRT674498	hsa-miR-8086	HITS-CLIP	23824327
MIRT674497	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT674496	hsa-miR-7158-3p	HITS-CLIP	23824327
MIRT674495	hsa-miR-203b-3p	HITS-CLIP	23824327
MIRT674494	hsa-miR-640	HITS-CLIP	23824327
MIRT674493	hsa-miR-548s	HITS-CLIP	23824327
MIRT674492	hsa-miR-4701-5p	HITS-CLIP	23824327
MIRT674491	hsa-miR-588	HITS-CLIP	23824327
MIRT674490	hsa-miR-4435	HITS-CLIP	23824327
MIRT674489	hsa-miR-3187-3p	HITS-CLIP	23824327
MIRT674488	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT674487	hsa-miR-3157-5p	HITS-CLIP	23824327
MIRT674506	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT674505	hsa-miR-764	HITS-CLIP	23824327
MIRT674504	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT674503	hsa-miR-4635	HITS-CLIP	23824327
MIRT674502	hsa-miR-4680-5p	HITS-CLIP	23824327
MIRT674501	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT674500	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT674499	hsa-miR-4755-3p	HITS-CLIP	23824327
MIRT674498	hsa-miR-8086	HITS-CLIP	23824327
MIRT674497	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT674496	hsa-miR-7158-3p	HITS-CLIP	23824327
MIRT674495	hsa-miR-203b-3p	HITS-CLIP	23824327
MIRT674494	hsa-miR-640	HITS-CLIP	23824327
MIRT674493	hsa-miR-548s	HITS-CLIP	23824327
MIRT674491	hsa-miR-588	HITS-CLIP	23824327
MIRT674490	hsa-miR-4435	HITS-CLIP	23824327
MIRT674489	hsa-miR-3187-3p	HITS-CLIP	23824327
MIRT674488	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT674487	hsa-miR-3157-5p	HITS-CLIP	23824327
MIRT674506	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT674505	hsa-miR-764	HITS-CLIP	23824327
MIRT674504	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT674503	hsa-miR-4635	HITS-CLIP	23824327
MIRT674502	hsa-miR-4680-5p	HITS-CLIP	23824327
MIRT674501	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT674500	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT674499	hsa-miR-4755-3p	HITS-CLIP	23824327
MIRT674498	hsa-miR-8086	HITS-CLIP	23824327
MIRT674497	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT674496	hsa-miR-7158-3p	HITS-CLIP	23824327
MIRT674495	hsa-miR-203b-3p	HITS-CLIP	23824327
MIRT674494	hsa-miR-640	HITS-CLIP	23824327
MIRT674493	hsa-miR-548s	HITS-CLIP	23824327
MIRT674492	hsa-miR-4701-5p	HITS-CLIP	23824327
MIRT674491	hsa-miR-588	HITS-CLIP	23824327
MIRT674490	hsa-miR-4435	HITS-CLIP	23824327
MIRT674489	hsa-miR-3187-3p	HITS-CLIP	23824327
MIRT674488	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT674487	hsa-miR-3157-5p	HITS-CLIP	23824327
MIRT1425640	hsa-miR-106a	CLIP-seq
MIRT1425641	hsa-miR-106b	CLIP-seq
MIRT1425642	hsa-miR-1180	CLIP-seq
MIRT1425643	hsa-miR-1234	CLIP-seq
MIRT1425644	hsa-miR-1275	CLIP-seq
MIRT1425645	hsa-miR-1289	CLIP-seq
MIRT1425646	hsa-miR-1343	CLIP-seq
MIRT1425647	hsa-miR-135a	CLIP-seq
MIRT1425648	hsa-miR-135b	CLIP-seq
MIRT1425649	hsa-miR-143	CLIP-seq
MIRT1425650	hsa-miR-145	CLIP-seq
MIRT1425651	hsa-miR-1470	CLIP-seq
MIRT1425652	hsa-miR-150	CLIP-seq
MIRT1425653	hsa-miR-17	CLIP-seq
MIRT1425654	hsa-miR-183	CLIP-seq
MIRT1425655	hsa-miR-198	CLIP-seq
MIRT1425656	hsa-miR-20a	CLIP-seq
MIRT1425657	hsa-miR-20b	CLIP-seq
MIRT1425658	hsa-miR-2355-5p	CLIP-seq
MIRT1425659	hsa-miR-2682	CLIP-seq
MIRT1425660	hsa-miR-302a	CLIP-seq
MIRT1425661	hsa-miR-302b	CLIP-seq
MIRT1425662	hsa-miR-302c	CLIP-seq
MIRT1425663	hsa-miR-302d	CLIP-seq
MIRT1425664	hsa-miR-302e	CLIP-seq
MIRT1425665	hsa-miR-3119	CLIP-seq
MIRT1425666	hsa-miR-3124-3p	CLIP-seq
MIRT1425667	hsa-miR-3145-5p	CLIP-seq
MIRT1425668	hsa-miR-3545-3p	CLIP-seq
MIRT1425669	hsa-miR-3667-3p	CLIP-seq
MIRT1425670	hsa-miR-3685	CLIP-seq
MIRT1425671	hsa-miR-372	CLIP-seq
MIRT1425672	hsa-miR-373	CLIP-seq
MIRT1425673	hsa-miR-383	CLIP-seq
MIRT1425674	hsa-miR-384	CLIP-seq
MIRT1425675	hsa-miR-3934	CLIP-seq
MIRT1425676	hsa-miR-410	CLIP-seq
MIRT1425677	hsa-miR-4278	CLIP-seq
MIRT1425678	hsa-miR-4297	CLIP-seq
MIRT1425679	hsa-miR-4316	CLIP-seq
MIRT1425680	hsa-miR-4421	CLIP-seq
MIRT1425681	hsa-miR-4423-3p	CLIP-seq
MIRT1425682	hsa-miR-4469	CLIP-seq
MIRT1425683	hsa-miR-4476	CLIP-seq
MIRT1425684	hsa-miR-4497	CLIP-seq
MIRT1425685	hsa-miR-449c	CLIP-seq
MIRT1425686	hsa-miR-4525	CLIP-seq
MIRT1425687	hsa-miR-4663	CLIP-seq
MIRT1425688	hsa-miR-4664-3p	CLIP-seq
MIRT1425689	hsa-miR-4665-5p	CLIP-seq
MIRT1425690	hsa-miR-4667-3p	CLIP-seq
MIRT1425691	hsa-miR-4704-3p	CLIP-seq
MIRT1425692	hsa-miR-4710	CLIP-seq
MIRT1425693	hsa-miR-4711-3p	CLIP-seq
MIRT1425694	hsa-miR-4716-3p	CLIP-seq
MIRT1425695	hsa-miR-4722-5p	CLIP-seq
MIRT1425696	hsa-miR-4723-5p	CLIP-seq
MIRT1425697	hsa-miR-4742-5p	CLIP-seq
MIRT1425698	hsa-miR-4768-3p	CLIP-seq
MIRT1425699	hsa-miR-4770	CLIP-seq
MIRT1425700	hsa-miR-4772-5p	CLIP-seq
MIRT1425701	hsa-miR-4792	CLIP-seq
MIRT1425702	hsa-miR-483-3p	CLIP-seq
MIRT1425703	hsa-miR-511	CLIP-seq
MIRT1425704	hsa-miR-512-3p	CLIP-seq
MIRT1425705	hsa-miR-516a-3p	CLIP-seq
MIRT1425706	hsa-miR-519d	CLIP-seq
MIRT1425707	hsa-miR-520a-3p	CLIP-seq
MIRT1425708	hsa-miR-520b	CLIP-seq
MIRT1425709	hsa-miR-520c-3p	CLIP-seq
MIRT1425710	hsa-miR-520d-3p	CLIP-seq
MIRT1425711	hsa-miR-520e	CLIP-seq
MIRT1425712	hsa-miR-520g	CLIP-seq
MIRT1425713	hsa-miR-520h	CLIP-seq
MIRT1425714	hsa-miR-592	CLIP-seq
MIRT1425715	hsa-miR-599	CLIP-seq
MIRT1425716	hsa-miR-615-5p	CLIP-seq
MIRT1425717	hsa-miR-625	CLIP-seq
MIRT1425718	hsa-miR-628-5p	CLIP-seq
MIRT1425719	hsa-miR-637	CLIP-seq
MIRT1425720	hsa-miR-645	CLIP-seq
MIRT1425721	hsa-miR-7	CLIP-seq
MIRT1425722	hsa-miR-93	CLIP-seq
MIRT1425723	hsa-miR-940	CLIP-seq
MIRT1425640	hsa-miR-106a	CLIP-seq
MIRT1425641	hsa-miR-106b	CLIP-seq
MIRT1425643	hsa-miR-1234	CLIP-seq
MIRT2127534	hsa-miR-134	CLIP-seq
MIRT1425652	hsa-miR-150	CLIP-seq
MIRT1425653	hsa-miR-17	CLIP-seq
MIRT1425656	hsa-miR-20a	CLIP-seq
MIRT1425657	hsa-miR-20b	CLIP-seq
MIRT1425660	hsa-miR-302a	CLIP-seq
MIRT1425661	hsa-miR-302b	CLIP-seq
MIRT1425662	hsa-miR-302c	CLIP-seq
MIRT1425663	hsa-miR-302d	CLIP-seq
MIRT1425664	hsa-miR-302e	CLIP-seq
MIRT2127535	hsa-miR-3065-5p	CLIP-seq
MIRT2127536	hsa-miR-3118	CLIP-seq
MIRT2127537	hsa-miR-3144-3p	CLIP-seq
MIRT2127538	hsa-miR-3164	CLIP-seq
MIRT1425668	hsa-miR-3545-3p	CLIP-seq
MIRT2127539	hsa-miR-3655	CLIP-seq
MIRT2127540	hsa-miR-3680	CLIP-seq
MIRT1425671	hsa-miR-372	CLIP-seq
MIRT1425672	hsa-miR-373	CLIP-seq
MIRT1425675	hsa-miR-3934	CLIP-seq
MIRT2127541	hsa-miR-421	CLIP-seq
MIRT2127542	hsa-miR-4277	CLIP-seq
MIRT2127543	hsa-miR-4695-3p	CLIP-seq
MIRT2127544	hsa-miR-4727-5p	CLIP-seq
MIRT2127545	hsa-miR-4760-3p	CLIP-seq
MIRT2127546	hsa-miR-4769-3p	CLIP-seq
MIRT1425702	hsa-miR-483-3p	CLIP-seq
MIRT2127547	hsa-miR-495	CLIP-seq
MIRT1425704	hsa-miR-512-3p	CLIP-seq
MIRT1425706	hsa-miR-519d	CLIP-seq
MIRT1425707	hsa-miR-520a-3p	CLIP-seq
MIRT1425708	hsa-miR-520b	CLIP-seq
MIRT1425709	hsa-miR-520c-3p	CLIP-seq
MIRT1425710	hsa-miR-520d-3p	CLIP-seq
MIRT1425711	hsa-miR-520e	CLIP-seq
MIRT1425712	hsa-miR-520g	CLIP-seq
MIRT1425713	hsa-miR-520h	CLIP-seq
MIRT2127548	hsa-miR-579	CLIP-seq
MIRT2127549	hsa-miR-664	CLIP-seq
MIRT2127550	hsa-miR-875-5p	CLIP-seq
MIRT1425722	hsa-miR-93	CLIP-seq
MIRT1425640	hsa-miR-106a	CLIP-seq
MIRT1425641	hsa-miR-106b	CLIP-seq
MIRT1425643	hsa-miR-1234	CLIP-seq
MIRT2349289	hsa-miR-1236	CLIP-seq
MIRT1425647	hsa-miR-135a	CLIP-seq
MIRT1425648	hsa-miR-135b	CLIP-seq
MIRT1425651	hsa-miR-1470	CLIP-seq
MIRT1425652	hsa-miR-150	CLIP-seq
MIRT1425653	hsa-miR-17	CLIP-seq
MIRT1425656	hsa-miR-20a	CLIP-seq
MIRT1425657	hsa-miR-20b	CLIP-seq
MIRT1425658	hsa-miR-2355-5p	CLIP-seq
MIRT1425660	hsa-miR-302a	CLIP-seq
MIRT1425661	hsa-miR-302b	CLIP-seq
MIRT1425662	hsa-miR-302c	CLIP-seq
MIRT1425663	hsa-miR-302d	CLIP-seq
MIRT1425664	hsa-miR-302e	CLIP-seq
MIRT1425667	hsa-miR-3145-5p	CLIP-seq
MIRT1425668	hsa-miR-3545-3p	CLIP-seq
MIRT2349290	hsa-miR-3614-5p	CLIP-seq
MIRT1425671	hsa-miR-372	CLIP-seq
MIRT1425672	hsa-miR-373	CLIP-seq
MIRT1425675	hsa-miR-3934	CLIP-seq
MIRT2349291	hsa-miR-412	CLIP-seq
MIRT1425682	hsa-miR-4469	CLIP-seq
MIRT2349292	hsa-miR-4645-5p	CLIP-seq
MIRT2349293	hsa-miR-4652-3p	CLIP-seq
MIRT1425687	hsa-miR-4663	CLIP-seq
MIRT1425690	hsa-miR-4667-3p	CLIP-seq
MIRT2349294	hsa-miR-4673	CLIP-seq
MIRT1425697	hsa-miR-4742-5p	CLIP-seq
MIRT1425702	hsa-miR-483-3p	CLIP-seq
MIRT1425704	hsa-miR-512-3p	CLIP-seq
MIRT1425706	hsa-miR-519d	CLIP-seq
MIRT1425707	hsa-miR-520a-3p	CLIP-seq
MIRT1425708	hsa-miR-520b	CLIP-seq
MIRT1425709	hsa-miR-520c-3p	CLIP-seq
MIRT1425710	hsa-miR-520d-3p	CLIP-seq
MIRT1425711	hsa-miR-520e	CLIP-seq
MIRT1425712	hsa-miR-520g	CLIP-seq
MIRT1425713	hsa-miR-520h	CLIP-seq
MIRT1425722	hsa-miR-93	CLIP-seq
MIRT2642659	hsa-miR-23a	CLIP-seq
MIRT2642660	hsa-miR-23b	CLIP-seq
MIRT2642661	hsa-miR-23c	CLIP-seq
MIRT2127537	hsa-miR-3144-3p	CLIP-seq
MIRT2127539	hsa-miR-3655	CLIP-seq
MIRT1425702	hsa-miR-483-3p	CLIP-seq
MIRT2127550	hsa-miR-875-5p	CLIP-seq

Show/Hide all (63)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	TAS	19509286
GO:0005080	Function	Protein kinase C binding	IPI	17161867
GO:0005515	Function	Protein binding	IPI	11544529, 17258210, 17360653, 17583698, 19509286, 19574958, 19948740, 21334391, 21829704, 21903422, 22155231, 24275656, 33961781
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	19948740
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	16751103
GO:0005886	Component	Plasma membrane	IDA	19948740
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	ISS
GO:0009986	Component	Cell surface	IDA	12447441
GO:0016020	Component	Membrane	IEA
GO:0030099	Process	Myeloid cell differentiation	ISS
GO:0030139	Component	Endocytic vesicle	ISS
GO:0030674	Function	Protein-macromolecule adaptor activity	NAS	19509286
GO:0030890	Process	Positive regulation of B cell proliferation	ISS
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IDA	16751103
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	12062447
GO:0032496	Process	Response to lipopolysaccharide	IDA	11544529
GO:0032587	Component	Ruffle membrane	ISS
GO:0032648	Process	Regulation of interferon-beta production	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	ISS
GO:0032738	Process	Positive regulation of interleukin-15 production	IDA	18583567
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	16301656
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	16301656
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IBA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	16301656, 19509286
GO:0034137	Process	Positive regulation of toll-like receptor 2 signaling pathway	IMP	19509286
GO:0034141	Process	Positive regulation of toll-like receptor 3 signaling pathway	ISS
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IBA
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	16751103
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	16751103
GO:0034145	Process	Positive regulation of toll-like receptor 4 signaling pathway	IMP	19509286
GO:0035591	Function	Signaling adaptor activity	IDA	16751103
GO:0035662	Function	Toll-like receptor 4 binding	IBA
GO:0035662	Function	Toll-like receptor 4 binding	IPI	19509286
GO:0035663	Function	Toll-like receptor 2 binding	IBA
GO:0035663	Function	Toll-like receptor 2 binding	IPI	19509286
GO:0035665	Process	TIRAP-dependent toll-like receptor 4 signaling pathway	IDA	11544529
GO:0042802	Function	Identical protein binding	IPI	17258210, 24275656
GO:0042802	Function	Identical protein binding	ISS
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	19509286, 24275656
GO:0045087	Process	Innate immune response	IEA
GO:0045088	Process	Regulation of innate immune response	IC	19509286
GO:0046330	Process	Positive regulation of JNK cascade	IMP	11544529
GO:0050830	Process	Defense response to Gram-positive bacterium	ISS
GO:0060090	Function	Molecular adaptor activity	IDA	11544529, 16751103
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	11544529
GO:0070935	Process	3'-UTR-mediated mRNA stabilization	IDA	15294994
GO:0071221	Process	Cellular response to bacterial lipopeptide	ISS
GO:0071223	Process	Cellular response to lipoteichoic acid	ISS
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	ISS
GO:2000340	Process	Positive regulation of chemokine (C-X-C motif) ligand 1 production	ISS
GO:2000343	Process	Positive regulation of chemokine (C-X-C motif) ligand 2 production	IBA
GO:2000343	Process	Positive regulation of chemokine (C-X-C motif) ligand 2 production	ISS

MIM	HGNC	e!Ensembl
606252	17192	ENSG00000150455

P58753

Protein name

Toll/interleukin-1 receptor domain-containing adapter protein (TIR domain-containing adapter protein) (Adaptor protein Wyatt) (MyD88 adapter-like protein) (MyD88-2)

Protein function

Adapter involved in TLR2, TLR4 and RAGE signaling pathways in the innate immune response. Acts via IRAK2 and TRAF-6, leading to the activation of NF-kappa-B, MAPK1, MAPK3 and JNK, and resulting in cytokine secretion and the inflammatory response

PDB

2NDH , 2Y92 , 3UB2 , 3UB3 , 3UB4 , 4FZ5 , 4LQD , 5T7Q , 5UZB , 8JZM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13676	TIR_2	88 → 211	TIR domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in liver, kidney, spleen, skeletal muscle and heart. Also detected in peripheral blood leukocytes, lung, placenta, small intestine, thymus, colon and brain.

Sequence

MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPS
LSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQL
RDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLS
GLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS

Sequence length

221

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Bacteremia, susceptibility	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bacteremia, susceptibility to, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Invasive pneumococcal disease, protection against	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malaria, resistance to	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malaria, susceptibility to	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mycobacterium tuberculosis, protection against	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mycobacterium tuberculosis, susceptibility to	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TIRAP-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TUBERCULOMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (145)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Actinic keratosis	Actinic keratosis	BEFREE	29136306, 29779986, 30633376, 31793041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	15561678, 18667423, 19287095, 22497198, 26215111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	19662663, 31258734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	17408629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	18346269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	18346269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	27879516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	16707382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	25182168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26482433	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	26100679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17255320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	26751474	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	26885859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	24088706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	24088706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	21705416, 24064014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19208741, 23011155, 24927296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	19208741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19208741, 19228724, 23011155, 24927296, 26452468, 35233921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	22058078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Head	Neoplasm of head	CTD_human_DG	19445022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Neck	Neck Cancer	CTD_human_DG	19445022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18346269, 26552048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12776198, 18346269, 23456988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	21092172	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21235780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	19662663, 21190187, 25281766, 30172480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	28545541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	15188492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	28829805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19642140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30660782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31423899		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	14718022, 23456988, 26219541, 26552048, 27430395, 30608989, 31067838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	23456988, 26219541, 30135508, 31067838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	23456988, 26219541, 26552048, 27430395, 30608989, 31067838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas Cardiomyopathy	BEFREE	19456234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas cardiomyopathy	Pubtator	24330528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24154872, 26482433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	18346269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18346269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18346269, 19002170, 21777459, 24362313, 25991403, 26482433, 28540987	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	28871230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	29121163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	15661927	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	21324962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	21399862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37538791	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31222667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	34583337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	10552968, 27879516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	25281766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35442481	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	19642140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	12776198, 17151798, 23224601, 24088706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	12776198, 17151798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	15188492, 24088706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30312846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30312846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	19445022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	CTD_human_DG	19445022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	19445022	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head Neoplasms	Head Neoplasms	CTD_human_DG	19445022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	16707382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	21399862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	17538633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	17538633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	17538633	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	19602285		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15561678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukodystrophy Metachromatic	Metachromatic leukodystrophy	Pubtator	35217805	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoplakia	Leukoplakia	BEFREE	28433800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12370246, 24023515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	12370246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	24469050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31978067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	34572591	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18417424, 25182168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	18417424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	34572591	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24511665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	20881207, 30381301	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	30381301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	28405493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	19445022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	CTD_human_DG	19445022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19208741, 23011155, 24927296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	19208741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	25281766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	12776198, 17151798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	12776198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19642140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	16284379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27708246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	29603761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19002170, 24929142, 27329150, 28259967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15561678, 15897565, 17151798, 18346269, 19208741, 19318476, 23224601, 23381221, 25111387, 26885859, 27430395, 30135508, 31258734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	23456988, 26219541, 26552048, 27430395, 30608989, 31067838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	19208741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	19208741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	19208741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	19208741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mediastinal (Thymic) Large B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	10552968, 15650839, 16224207, 16707382, 27879516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	30172480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	25029526	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	26564000	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	16036357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	CTD_human_DG	19445022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	21529841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12776198, 15168355, 15188492, 16952549, 19002170, 19208741, 19732125, 21190187, 23011155, 29213215, 29934435, 30291474, 31258734, 31686522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	25182168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	32415241	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteolysis	Osteolysis	Pubtator	25399506	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19208741, 28545541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34499727	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Inflammatory Disease	Pelvic inflammatory disease	Pubtator	23255565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27708246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15466889		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	16284379		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21694441, 27708246	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	BEFREE	25182168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	30131804	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	18180278, 21324962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	18292575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorimotor neuropathy	Sensorimotor neuropathy	BEFREE	30298599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	19602285, 20525286, 21118491	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	19602285, 20525286, 21118491, 30909134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	18073264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15188492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19445022, 19662663, 29603761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	19445022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19445022, 19835631	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21092172	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	28199463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	20162572, 21092172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19002170, 24929142, 27329150, 28259967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	19002170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19002170, 24511665, 32799763	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Upper Aerodigestive Tract Neoplasms	Upper Aerodigestive Tract Neoplasms	CTD_human_DG	19445022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35123558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	24508839, 30172480, 35241698	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23176198, 26768780, 30135508, 31067838, 34323415, 36011276	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	31620122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	34995294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TIRAP (TIR domain containing adaptor protein)