TINCR (TINCR ubiquitin domain containing)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 257000 |
| Gene name | TINCR ubiquitin domain containing |
| Gene symbol | TINCR |
| Synonyms (NCBI Gene) |
LINC00036NCRNA00036PLAC2TUBLonco-lncRNA-16
|
| Chromosome | 19 |
| Chromosome location | 19p13.3 |
| Summary | This gene produces a spliced long non-coding RNA that binds RNAs. This transcript interacts with staufen-1 protein to regulate the stability of mRNAs for genes involved in the differentiation of epidermal tissue. Variation in this gene may be associated w |
|
miRNA
miRNA information provided by mirtarbase database.
2
|
|||||||||||||
|
|||||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
A0A2R8Y7D0 |
| Protein name | Ubiquitin domain-containing protein TINCR (Placenta-specific protein 2) (Terminal differentiation-induced cornification regulator) |
| PDB | 7MRJ |
| Family and domains | |
| Tissue specificity | TISSUE SPECIFICITY: Detected in stratum corneum (at protein level). {ECO:0000269|PubMed:32012357}. |
| Sequence |
MEGLRRGLSRWKRYHIKVHLADEALLLPLTVRPRDTLSDLRAQLVGQGVSSWKRAFYYNA |
| Sequence length | 120 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with TINCR across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to TINCR (see Related Genes above), that are NOT already directly curated for TINCR itself -- a lead worth checking, not a confirmed association.
0
|
|