TIMM9 (translocase of inner mitochondrial membrane 9)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 26520
• Gene name: Translocase of inner mitochondrial membrane 9
• Gene symbol: TIMM9
• Synonyms (NCBI Gene): TIM9, TIM9A
• Chromosome: 14
• Chromosome location: 14q23.1
• Summary: TIMM9 belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondri

miRNA Show/Hide all (77)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028632	hsa-miR-30a-5p	Proteomics	18668040
MIRT032455	hsa-let-7b-5p	Proteomics	18668040
MIRT1425138	hsa-miR-1245b-3p	CLIP-seq
MIRT1425139	hsa-miR-1343	CLIP-seq
MIRT1425140	hsa-miR-299-5p	CLIP-seq
MIRT1425141	hsa-miR-3121-3p	CLIP-seq
MIRT1425142	hsa-miR-3127-5p	CLIP-seq
MIRT1425143	hsa-miR-3160-5p	CLIP-seq
MIRT1425144	hsa-miR-323b-3p	CLIP-seq
MIRT1425145	hsa-miR-361-5p	CLIP-seq
MIRT1425146	hsa-miR-3667-5p	CLIP-seq
MIRT1425147	hsa-miR-3908	CLIP-seq
MIRT1425148	hsa-miR-3942-5p	CLIP-seq
MIRT1425149	hsa-miR-4263	CLIP-seq
MIRT1425150	hsa-miR-4320	CLIP-seq
MIRT1425151	hsa-miR-4420	CLIP-seq
MIRT1425152	hsa-miR-4422	CLIP-seq
MIRT1425153	hsa-miR-4450	CLIP-seq
MIRT1425154	hsa-miR-4490	CLIP-seq
MIRT1425155	hsa-miR-4703-5p	CLIP-seq
MIRT1425156	hsa-miR-4724-5p	CLIP-seq
MIRT1425157	hsa-miR-4753-5p	CLIP-seq
MIRT1425158	hsa-miR-4766-3p	CLIP-seq
MIRT1425159	hsa-miR-4795-3p	CLIP-seq
MIRT1425160	hsa-miR-576-5p	CLIP-seq
MIRT2127416	hsa-miR-132	CLIP-seq
MIRT2127417	hsa-miR-212	CLIP-seq
MIRT1425140	hsa-miR-299-5p	CLIP-seq
MIRT1425142	hsa-miR-3127-5p	CLIP-seq
MIRT1425143	hsa-miR-3160-5p	CLIP-seq
MIRT1425145	hsa-miR-361-5p	CLIP-seq
MIRT1425149	hsa-miR-4263	CLIP-seq
MIRT1425150	hsa-miR-4320	CLIP-seq
MIRT1425153	hsa-miR-4450	CLIP-seq
MIRT2127418	hsa-miR-4776-3p	CLIP-seq
MIRT2127419	hsa-miR-563	CLIP-seq
MIRT1425160	hsa-miR-576-5p	CLIP-seq
MIRT2127416	hsa-miR-132	CLIP-seq
MIRT1425139	hsa-miR-1343	CLIP-seq
MIRT2127417	hsa-miR-212	CLIP-seq
MIRT1425141	hsa-miR-3121-3p	CLIP-seq
MIRT1425142	hsa-miR-3127-5p	CLIP-seq
MIRT1425143	hsa-miR-3160-5p	CLIP-seq
MIRT1425145	hsa-miR-361-5p	CLIP-seq
MIRT1425146	hsa-miR-3667-5p	CLIP-seq
MIRT1425147	hsa-miR-3908	CLIP-seq
MIRT1425148	hsa-miR-3942-5p	CLIP-seq
MIRT1425149	hsa-miR-4263	CLIP-seq
MIRT1425150	hsa-miR-4320	CLIP-seq
MIRT1425153	hsa-miR-4450	CLIP-seq
MIRT1425154	hsa-miR-4490	CLIP-seq
MIRT1425155	hsa-miR-4703-5p	CLIP-seq
MIRT1425158	hsa-miR-4766-3p	CLIP-seq
MIRT2127419	hsa-miR-563	CLIP-seq
MIRT1425160	hsa-miR-576-5p	CLIP-seq
MIRT1425138	hsa-miR-1245b-3p	CLIP-seq
MIRT2642544	hsa-miR-182	CLIP-seq
MIRT1425142	hsa-miR-3127-5p	CLIP-seq
MIRT1425143	hsa-miR-3160-5p	CLIP-seq
MIRT1425144	hsa-miR-323b-3p	CLIP-seq
MIRT1425145	hsa-miR-361-5p	CLIP-seq
MIRT1425150	hsa-miR-4320	CLIP-seq
MIRT1425152	hsa-miR-4422	CLIP-seq
MIRT1425153	hsa-miR-4450	CLIP-seq
MIRT2127419	hsa-miR-563	CLIP-seq
MIRT2642545	hsa-miR-646	CLIP-seq
MIRT1425138	hsa-miR-1245b-3p	CLIP-seq
MIRT2642544	hsa-miR-182	CLIP-seq
MIRT1425142	hsa-miR-3127-5p	CLIP-seq
MIRT1425143	hsa-miR-3160-5p	CLIP-seq
MIRT1425144	hsa-miR-323b-3p	CLIP-seq
MIRT1425145	hsa-miR-361-5p	CLIP-seq
MIRT1425150	hsa-miR-4320	CLIP-seq
MIRT1425152	hsa-miR-4422	CLIP-seq
MIRT1425153	hsa-miR-4450	CLIP-seq
MIRT2127419	hsa-miR-563	CLIP-seq
MIRT2642545	hsa-miR-646	CLIP-seq

Gene ontology (GO) Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	14726512, 30021884, 33961781
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IBA
GO:0005743	Component	Mitochondrial inner membrane	IDA	14726512, 32901109
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005758	Component	Mitochondrial intermembrane space	IDA	14726512
GO:0005758	Component	Mitochondrial intermembrane space	NAS	16387659
GO:0005758	Component	Mitochondrial intermembrane space	TAS	14726512
GO:0006626	Process	Protein targeting to mitochondrion	TAS	10552927
GO:0007605	Process	Sensory perception of sound	TAS	10552927
GO:0008270	Function	Zinc ion binding	TAS	10552927
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0032977	Function	Membrane insertase activity	IDA	16387659
GO:0042719	Component	Mitochondrial intermembrane space chaperone complex	IDA	14726512
GO:0042719	Component	Mitochondrial intermembrane space chaperone complex	IEA
GO:0042719	Component	Mitochondrial intermembrane space chaperone complex	IPI	14726512, 16387659
GO:0042719	Component	Mitochondrial intermembrane space chaperone complex	TAS	10552927
GO:0042721	Component	TIM22 mitochondrial import inner membrane insertion complex	IPI	32901109
GO:0042803	Function	Protein homodimerization activity	IPI	16387659
GO:0045039	Process	Protein insertion into mitochondrial inner membrane	IBA
GO:0045039	Process	Protein insertion into mitochondrial inner membrane	IDA	16387659, 32901109
GO:0045039	Process	Protein insertion into mitochondrial inner membrane	IEA
GO:0045039	Process	Protein insertion into mitochondrial inner membrane	ISS	14726512
GO:0045039	Process	Protein insertion into mitochondrial inner membrane	NAS	14726512
GO:0046872	Function	Metal ion binding	IEA
GO:0051087	Function	Protein-folding chaperone binding	IPI	16387659
GO:0140318	Function	Protein transporter activity	IBA

Other IDs

• MIM: 607384
• HGNC: 11819
• e!Ensembl: ENSG00000100575

Protein

• UniProt ID: Q9Y5J7
• Protein name: Mitochondrial import inner membrane translocase subunit Tim9
• Protein function: Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex
• PDB: 2BSK , 7CGP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02953	zf-Tim10_DDP	8 → 69	Tim10/DDP family zinc finger	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous, with highest expression in heart, kidney, liver and skeletal muscle. {ECO:0000269|PubMed:10552927, ECO:0000269|PubMed:10611480}.
• Sequence:

  MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMT
  QRISMRFQEYHIQQNEALAAKAGLLGQPR

• Sequence length: 89

Pathways

Reactome Pathway:

Mitochondrial protein import

Related Genes

No strongly related genes found yet for TIMM9.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to TIMM9.