TIMM23B (translocase of inner mitochondrial membrane 23 homolog B)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 100652748
• Gene name: Translocase of inner mitochondrial membrane 23 homolog B
• Gene symbol: TIMM23B
• Synonyms (NCBI Gene): -
• Chromosome: 10
• Chromosome location: 10q11.23

miRNA Show/Hide all (6)

miRTarBase ID	miRNA	Experiments	Reference
MIRT626840	hsa-miR-548ac	HITS-CLIP	23824327
MIRT626839	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT626838	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT626837	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT626836	hsa-miR-548z	HITS-CLIP	23824327
MIRT626835	hsa-miR-944	HITS-CLIP	23824327

Gene ontology (GO) Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005744	Component	TIM23 mitochondrial import inner membrane translocase complex	IBA
GO:0005744	Component	TIM23 mitochondrial import inner membrane translocase complex	IEA
GO:0008320	Function	Protein transmembrane transporter activity	IBA
GO:0008320	Function	Protein transmembrane transporter activity	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0030150	Process	Protein import into mitochondrial matrix	IBA
GO:0030150	Process	Protein import into mitochondrial matrix	IEA

Other IDs

• MIM: 620758
• HGNC: 23581
• e!Ensembl: ENSG00000204152

Protein

• UniProt ID: Q5SRD1
• Protein name: Mitochondrial import inner membrane translocase subunit Tim23B (TIMM23B)
• Protein function: May participate in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. the PAM complex (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02466	Tim17	76 → 193		Family

• Sequence:

  MEGGGGSGDKTTGVLAGFFGAGEAGYSHADLAGVPLTGMNPLCPYLNVDPRYLVQDTDEF
  ILPTGANKTWGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPGNVQILNMV
  TRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTVSEMALDSP
  FCVLLSGS

• Sequence length: 188

Related Genes

No strongly related genes found yet for TIMM23B.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to TIMM23B.