TIMM13 (translocase of inner mitochondrial membrane 13)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 26517
• Gene name: Translocase of inner mitochondrial membrane 13
• Gene symbol: TIMM13
• Synonyms (NCBI Gene): TIM13, TIM13B, TIMM13A, TIMM13B, ppv1
• Chromosome: 19
• Chromosome location: 19p13.3
• Summary: This gene encodes a member of the evolutionarily conserved TIMM (translocase of inner mitochondrial membrane) family of proteins that function as chaperones in the import of proteins from the cytoplasm into the mitochondrial inner membrane. Proteins of th

miRNA Show/Hide all (94)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020650	hsa-miR-155-5p	Proteomics	18668040
MIRT022592	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT027528	hsa-miR-98-5p	Microarray	19088304
MIRT031620	hsa-miR-16-5p	Proteomics	18668040
MIRT036141	hsa-miR-1296-5p	CLASH	23622248
MIRT726325	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT726324	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT031620	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT726323	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT1424882	hsa-miR-1207-5p	CLIP-seq
MIRT1424883	hsa-miR-1909	CLIP-seq
MIRT1424884	hsa-miR-2277-3p	CLIP-seq
MIRT1424885	hsa-miR-3064-5p	CLIP-seq
MIRT1424886	hsa-miR-3652	CLIP-seq
MIRT1424887	hsa-miR-3689d	CLIP-seq
MIRT1424888	hsa-miR-3907	CLIP-seq
MIRT1424889	hsa-miR-4271	CLIP-seq
MIRT1424890	hsa-miR-4430	CLIP-seq
MIRT1424891	hsa-miR-4459	CLIP-seq
MIRT1424892	hsa-miR-4505	CLIP-seq
MIRT1424893	hsa-miR-4532	CLIP-seq
MIRT1424894	hsa-miR-4722-5p	CLIP-seq
MIRT1424895	hsa-miR-4725-3p	CLIP-seq
MIRT1424896	hsa-miR-4733-3p	CLIP-seq
MIRT1424897	hsa-miR-4736	CLIP-seq
MIRT1424898	hsa-miR-4747-5p	CLIP-seq
MIRT1424899	hsa-miR-4763-3p	CLIP-seq
MIRT1424900	hsa-miR-4793-3p	CLIP-seq
MIRT1424901	hsa-miR-542-3p	CLIP-seq
MIRT1424902	hsa-miR-548q	CLIP-seq
MIRT1424903	hsa-miR-892b	CLIP-seq
MIRT2127292	hsa-miR-1202	CLIP-seq
MIRT2127293	hsa-miR-124	CLIP-seq
MIRT2127294	hsa-miR-1587	CLIP-seq
MIRT2127295	hsa-miR-296-5p	CLIP-seq
MIRT2127296	hsa-miR-3194-5p	CLIP-seq
MIRT2127297	hsa-miR-378g	CLIP-seq
MIRT2127298	hsa-miR-3918	CLIP-seq
MIRT2127299	hsa-miR-3972	CLIP-seq
MIRT2127300	hsa-miR-4252	CLIP-seq
MIRT2127301	hsa-miR-4476	CLIP-seq
MIRT2127302	hsa-miR-4492	CLIP-seq
MIRT2127303	hsa-miR-4498	CLIP-seq
MIRT2127304	hsa-miR-4656	CLIP-seq
MIRT2127305	hsa-miR-4675	CLIP-seq
MIRT2127306	hsa-miR-4685-5p	CLIP-seq
MIRT2127307	hsa-miR-4740-3p	CLIP-seq
MIRT2127308	hsa-miR-4741	CLIP-seq
MIRT2127309	hsa-miR-4758-3p	CLIP-seq
MIRT2127310	hsa-miR-506	CLIP-seq
MIRT2127311	hsa-miR-762	CLIP-seq
MIRT2127312	hsa-miR-873	CLIP-seq
MIRT2349123	hsa-miR-1280	CLIP-seq
MIRT2349124	hsa-miR-214	CLIP-seq
MIRT2349125	hsa-miR-324-5p	CLIP-seq
MIRT2349126	hsa-miR-330-3p	CLIP-seq
MIRT2349127	hsa-miR-3619-5p	CLIP-seq
MIRT2349128	hsa-miR-3940-3p	CLIP-seq
MIRT2349129	hsa-miR-4291	CLIP-seq
MIRT2349130	hsa-miR-4768-5p	CLIP-seq
MIRT2349131	hsa-miR-4783-3p	CLIP-seq
MIRT2349132	hsa-miR-512-5p	CLIP-seq
MIRT2349133	hsa-miR-761	CLIP-seq
MIRT2349134	hsa-miR-922	CLIP-seq
MIRT2127293	hsa-miR-124	CLIP-seq
MIRT2127295	hsa-miR-296-5p	CLIP-seq
MIRT2127298	hsa-miR-3918	CLIP-seq
MIRT2395804	hsa-miR-4436b-5p	CLIP-seq
MIRT2127301	hsa-miR-4476	CLIP-seq
MIRT2127307	hsa-miR-4740-3p	CLIP-seq
MIRT2127309	hsa-miR-4758-3p	CLIP-seq
MIRT2127310	hsa-miR-506	CLIP-seq
MIRT2127312	hsa-miR-873	CLIP-seq
MIRT2461480	hsa-miR-1236	CLIP-seq
MIRT2461481	hsa-miR-3664-3p	CLIP-seq
MIRT2127292	hsa-miR-1202	CLIP-seq
MIRT2127293	hsa-miR-124	CLIP-seq
MIRT2127294	hsa-miR-1587	CLIP-seq
MIRT2127296	hsa-miR-3194-5p	CLIP-seq
MIRT2127297	hsa-miR-378g	CLIP-seq
MIRT2127298	hsa-miR-3918	CLIP-seq
MIRT2127299	hsa-miR-3972	CLIP-seq
MIRT2127300	hsa-miR-4252	CLIP-seq
MIRT2127301	hsa-miR-4476	CLIP-seq
MIRT2127302	hsa-miR-4492	CLIP-seq
MIRT2127303	hsa-miR-4498	CLIP-seq
MIRT2127304	hsa-miR-4656	CLIP-seq
MIRT2127305	hsa-miR-4675	CLIP-seq
MIRT2127308	hsa-miR-4741	CLIP-seq
MIRT2127310	hsa-miR-506	CLIP-seq
MIRT2127311	hsa-miR-762	CLIP-seq
MIRT2127312	hsa-miR-873	CLIP-seq
MIRT2693182	hsa-miR-134	CLIP-seq
MIRT2693183	hsa-miR-3118	CLIP-seq

Gene ontology (GO) Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001650	Component	Fibrillar center	IDA
GO:0005515	Function	Protein binding	IPI	11956200, 32296183, 33961781
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	24746669
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005758	Component	Mitochondrial intermembrane space	NAS	11956200
GO:0006626	Process	Protein targeting to mitochondrion	TAS	10552927
GO:0007605	Process	Sensory perception of sound	TAS	10552927
GO:0008270	Function	Zinc ion binding	TAS	10552927
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0042719	Component	Mitochondrial intermembrane space chaperone complex	IBA
GO:0042719	Component	Mitochondrial intermembrane space chaperone complex	IEA
GO:0042719	Component	Mitochondrial intermembrane space chaperone complex	IPI	11875042, 11956200
GO:0042719	Component	Mitochondrial intermembrane space chaperone complex	ISS
GO:0042719	Component	Mitochondrial intermembrane space chaperone complex	TAS	10552927
GO:0045039	Process	Protein insertion into mitochondrial inner membrane	IBA
GO:0045039	Process	Protein insertion into mitochondrial inner membrane	IEA
GO:0045039	Process	Protein insertion into mitochondrial inner membrane	IMP	11875042
GO:0045039	Process	Protein insertion into mitochondrial inner membrane	NAS	11956200
GO:0045039	Process	Protein insertion into mitochondrial inner membrane	TAS	16387659
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 607383
• HGNC: 11816
• e!Ensembl: ENSG00000099800

Protein

• UniProt ID: Q9Y5L4
• Protein name: Mitochondrial import inner membrane translocase subunit Tim13
• Protein function: Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02953	zf-Tim10_DDP	24 → 86	Tim10/DDP family zinc finger	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous, with highest expression in heart, kidney, liver and skeletal muscle.
• Sequence:

  MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDN
  SEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM

• Sequence length: 95

Related Genes

No strongly related genes found yet for TIMM13.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to TIMM13.