TIGD7 (tigger transposable element derived 7)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 91151
Gene name Tigger transposable element derived 7
Gene symbol TIGD7
Synonyms (NCBI Gene)
Sancho
Chromosome 16
Chromosome location 16p13.3
Summary The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposa
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003677 Function DNA binding IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 25416956
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
612969 18331 ENSG00000140993
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6NT04
Protein name Tigger transposable element-derived protein 7
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03184 DDE_1 207 → 399 DDE superfamily endonuclease Family
PF03221 HTH_Tnp_Tc5 77 → 139 Tc5 transposase DNA-binding domain Domain
PF04218 CENP-B_N 4 → 56 CENP-B N-terminal DNA-binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in all tissues tested. Higher expression in testis and ovary. {ECO:0000269|PubMed:15487591}.
Sequence 
MNKRGKYTTLNLEEKMKVLSRIEAGRSLKSVMDEFGISKSTFYDIKKNKKLILDFVLKQD
MPLVGAEKRKRTTGAKYGDVDDAVYMWYQQKRSAGVPVRGVELQAAAERFARCFGRTDFK
ASTGWLFRFRNRHAIGNRKGCGEQVLSSVSENVEPFRQKLSMIIKEEKLCLAQLYSGDET
DLFWKSMPENSQASRKDICLPGKKINKERLSAFLCANADGTHKLKSIIIGKSKLPKSVKE
DTSTLPVIYKPSKDVWFTRELFSEWFFQNFVPEVRHFQLNVLRFHDEDVRALLLLDSCPA
HPSSESLTSEDGRIKCMFFPHNTSTLIQPMNQGVILSCKRLYRWKQLEESLVIFEESDDE
QEKGDKGVSKIKIYNIKSAIFNWAKSWEEVKQITIANAWENLLYKKEPEYDFQGLEHGDY
REILEKCGELETKLDDDRVWLNGDEEKGCLLKTKGGITKEVVQKGGEAEKQTAEFKLSAV
RESLDYLLDFVDATPEFQRFHFTLKEMQQEIVKKQFQSKIHSRIGSFLKPRPHNIKDSFS
GPSTSGSNH
Sequence length 549
Interactions View interactions

No strongly related genes found yet for TIGD7.

No additional diseases found yet through genes similar to TIGD7.