Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	220359
Gene name	Tigger transposable element derived 3
Gene symbol	TIGD3
Synonyms (NCBI Gene)	-
Chromosome	11
Chromosome location	11q13.1
Summary	The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposa

9 Show/Hide all (9)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017433	hsa-miR-335-5p	Microarray	18185580
MIRT051182	hsa-miR-16-5p	CLASH	23622248
MIRT1424750	hsa-miR-3942-3p	CLIP-seq
MIRT1424751	hsa-miR-452	CLIP-seq
MIRT1424752	hsa-miR-4676-3p	CLIP-seq
MIRT2127241	hsa-miR-1182	CLIP-seq
MIRT2127242	hsa-miR-498	CLIP-seq
MIRT2127243	hsa-miR-601	CLIP-seq
MIRT2127244	hsa-miR-942	CLIP-seq

6 Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA

MIM	HGNC	e!Ensembl
619084	18334	ENSG00000173825

Q6B0B8

Protein name

Tigger transposable element-derived protein 3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03184	DDE_1	192 → 360	DDE superfamily endonuclease	Family
PF03221	HTH_Tnp_Tc5	76 → 137	Tc5 transposase DNA-binding domain	Domain
PF04218	CENP-B_N	6 → 59	CENP-B N-terminal DNA-binding domain	Domain

Sequence

MELSSKKKLHALSLAEKIQVLELLDESKMSQSEVARRFQVSQPQISRICKNKEKLLADWC
SGTANRERKRKRESKYSGIDEALLCWYHIARAKAWDVTGPMLLHKAKELADIMGQDFVPS
IGWLVRWKRRNNVGFGARHVLAPSFPPEPPPPGLTSQAQLPLSLKDFSPEDVFGCAELPL
LYRAVPGSFGACDQVQVLLCANSRGTEKRRVLLGGLQAAPRCFFGIRSEALPASYHPDLG
IPWLEWLAQFDRDMGQQGRQVALLLAARVVEELAGLPGLYHVKLLPLAASSTTPPLPSSV
VRAFKAHYRHRLLGKLAAIQSERDGTSLAEAGAGITVLDALHVASAAWAKVPPQLIFSSF
IQEGLAPGKTPPSSHKTSEMPPVPGGLSLEEFSRFVDLEGEEPRSGVCKEEIGTEDEKGD
REGAFEPLPTKADALRALGTLRRWFECNSTSPELFEKFYDCEEEVERLCCL

Sequence length

471

Interactions

View interactions

Related Genes Genes most often co-reported with TIGD3 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for TIGD3.

Diseases Linked via Similar Genes Diseases curated for genes most similar to TIGD3 (see Related Genes above), that are NOT already directly curated for TIGD3 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to TIGD3.

TIGD3 (tigger transposable element derived 3)

Save This Analysis