Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	284486
Gene name	Thioesterase superfamily member 5
Gene symbol	THEM5
Synonyms (NCBI Gene)	ACOT15
Chromosome	1
Chromosome location	1q21.3

miRTarBase ID	miRNA	Experiments	Reference
MIRT2126844	hsa-miR-1915	CLIP-seq
MIRT2126845	hsa-miR-4726-3p	CLIP-seq

18 Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IBA
GO:0005759	Component	Mitochondrial matrix	IDA	22586271
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0035336	Process	Long-chain fatty-acyl-CoA metabolic process	IBA
GO:0035336	Process	Long-chain fatty-acyl-CoA metabolic process	IDA	22586271
GO:0035336	Process	Long-chain fatty-acyl-CoA metabolic process	IEA
GO:0035336	Process	Long-chain fatty-acyl-CoA metabolic process	ISS
GO:0044281	Process	Small molecule metabolic process	IEA
GO:0052816	Function	Long-chain fatty acyl-CoA hydrolase activity	IBA
GO:0052816	Function	Long-chain fatty acyl-CoA hydrolase activity	IDA	22586271
GO:0052816	Function	Long-chain fatty acyl-CoA hydrolase activity	IEA

MIM	HGNC	e!Ensembl
615653	26755	ENSG00000196407

Q8N1Q8

Protein name

Acyl-coenzyme A thioesterase THEM5 (Acyl-CoA thioesterase THEM5) (EC 3.1.2.2) (Acyl-coenzyme A thioesterase 15) (Thioesterase superfamily member 5)

Protein function

Has acyl-CoA thioesterase activity towards long-chain (C16 and C18) fatty acyl-CoA substrates, with a preference for linoleoyl-CoA and other unsaturated long-chain fatty acid-CoA esters (PubMed:22586271). Plays an important role in mitochondrial

PDB

4AE7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03061	4HBT	154 → 229	Thioesterase superfamily	Domain

Sequence

MIRRCFQVAARLGHHRGLLEAPRILPRLNPASAFGSSTDSMFSRFLPEKTDLKDYALPNA
SWCSDMLSLYQEFLEKTKSSGWIKLPSFKSNRDHIRGLKLPSGLAVSSDKGDCRIFTRCI
QVEGQGFEYVIFFQPTQKKSVCLFQPGSYLEGPPGFAHGGSLAAMMDETFSKTAFLAGEG
LFTLSLNIRFKNLIPVDSLVVMDVELDKIEDQKLYMSCIAHSRDQQTVYAKSSGVFLQLQ
LEEESPQ

Sequence length

247

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Fatty acid elongation	Mitochondrial Fatty Acid Beta-Oxidation
Metabolic pathways

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Hepatocellular carcinoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Fatty Liver	Fatty Liver	BEFREE	22586271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	28611204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	22586271		★★★★★ ★☆☆☆☆ Found in Text Mining only
VENTRICULAR TACHYCARDIA, CATECHOLAMINERGIC POLYMORPHIC, 1 (disorder)	Catecholaminergic polymorphic ventricular tachycardia	BEFREE	29032884		★★★★★ ★☆☆☆☆ Found in Text Mining only

THEM5 (thioesterase superfamily member 5)

Bookmark This Gene