THAP7 (THAP domain containing 7)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 80764
• Gene name: THAP domain containing 7
• Gene symbol: THAP7
• Synonyms (NCBI Gene): -
• Chromosome: 22
• Chromosome location: 22q11.21

miRNA Show/Hide all (11)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051196	hsa-miR-16-5p	CLASH	23622248
MIRT041375	hsa-miR-193b-3p	CLASH	23622248
MIRT2466222	hsa-miR-1910	CLIP-seq
MIRT2466223	hsa-miR-338-3p	CLIP-seq
MIRT2466224	hsa-miR-4530	CLIP-seq
MIRT2466225	hsa-miR-455-3p	CLIP-seq
MIRT2466222	hsa-miR-1910	CLIP-seq
MIRT2466223	hsa-miR-338-3p	CLIP-seq
MIRT2466224	hsa-miR-4530	CLIP-seq
MIRT2466225	hsa-miR-455-3p	CLIP-seq
MIRT2693112	hsa-miR-4749-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	15561719, 16195249
GO:0000785	Component	Chromatin	IDA	15561719
GO:0001222	Function	Transcription corepressor binding	IDA	15561719
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 17577209, 21988832, 25416956, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IEA
GO:0006325	Process	Chromatin organization	IDA	16195249
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016607	Component	Nuclear speck	IDA	17577209
GO:0031965	Component	Nuclear membrane	IDA
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0042826	Function	Histone deacetylase binding	IDA	15561719
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	17577209
GO:0046872	Function	Metal ion binding	IEA
GO:0070742	Function	C2H2 zinc finger domain binding	IDA	17577209
GO:0140008	Function	Histone H4 reader activity	IDA	15561719
GO:0140296	Function	General transcription initiation factor binding	IDA	15561719
GO:0140566	Function	Histone reader activity	IDA	15561719, 16195249

Other IDs

• MIM: 609518
• HGNC: 23190
• e!Ensembl: ENSG00000184436

Protein

• UniProt ID: Q9BT49
• Protein name: THAP domain-containing protein 7
• Protein function: Chromatin-associated, histone tail-binding protein that represses transcription via recruitment of HDAC3 and nuclear hormone receptor corepressors.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05485	THAP	5 → 93	THAP domain	Domain

• Sequence:

  MPRHCSAAGCCTRDTRETRNRGISFHRLPKKDNPRRGLWLANCQRLDPSGQGLWDPASEY
  IYFCSKHFEEDCFELVGISGYHRLKEGAVPTIFESFSKLRRTTKTKGHSYPPGPAEVSRL
  RRCRKRCSEGRGPTTPFSPPPPADVTCFPVEEASAPATLPASPAGRLEPGLSSPFSDLLG
  PLGAQADEAGCSAQPSPERQPSPLEPRPVSPSAYMLRLPPPAGAYIQNEHSYQVGSALLW
  KRRAEAALDALDKAQRQLQACKRREQRLRLRLTKLQQERAREKRAQADARQTLKEHVQDF
  AMQLSSSMA

• Sequence length: 309

Related Genes

No strongly related genes found yet for THAP7.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to THAP7.